Gene Gene information from NCBI Gene database.
Entrez ID 10715
Gene name Ceramide synthase 1
Gene symbol CERS1
Synonyms (NCBI Gene)
EPM8GDF-1GDF1LAG1LASS1UOG1
Chromosome 19
Chromosome location 19p13.11
Summary This gene encodes a ceramide synthase enzyme, which catalyzes the synthesis of ceramide, the hydrophobic moiety of sphingolipids. The encoded enzyme synthesizes 18-carbon (C18) ceramide in brain neurons. Elevated expression of this gene may be associated
miRNA miRNA information provided by mirtarbase database.
166
miRTarBase ID miRNA Experiments Reference
MIRT049351 hsa-miR-92a-3p CLASH 23622248
MIRT048708 hsa-miR-99a-5p CLASH 23622248
MIRT037949 hsa-miR-505-5p CLASH 23622248
MIRT453210 hsa-miR-6784-5p HITS-CLIP 23706177
MIRT453209 hsa-miR-4508 HITS-CLIP 23706177
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IDA 17699106, 19800881, 24782409
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0006629 Process Lipid metabolic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606919 14253 ENSG00000223802
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P27544
Protein name Ceramide synthase 1 (CerS1) (LAG1 longevity assurance homolog 1) (Longevity assurance gene 1 protein homolog 1) (Protein UOG-1) (Sphingoid base N-stearoyltransferase CERS1) (EC 2.3.1.299)
Protein function Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward stearoyl-CoA (octadecanoyl-CoA; C18:0-CoA) (PubMed:17977534, PubMed:23530041, PubMed:26887952, PubMed:31916624). N-ac
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03798 TRAM_LAG1_CLN8 98 304 TLC domain Domain
Sequence
MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL
LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL
FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML
LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA
DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL
YIVA
FAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Sequence length 350
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway
  Sphingolipid de novo biosynthesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
274
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Congenital heart defects, multiple types, 6 Likely pathogenic rs2145985085 RCV001733713
Progressive myoclonic epilepsy type 8 Pathogenic rs200024180 RCV000161146
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
CERS1-related disorder Likely benign; Uncertain significance rs577485199, rs200024180, rs530273200, rs749902200, rs868136098, rs369177504 RCV003948424
RCV003960936
RCV003936279
RCV003961439
RCV003935533
RCV003903093
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 25724183
Coronary Artery Disease Associate 37298446
Endometriosis Associate 35992117
Epileptic Encephalopathy Early Infantile 3 Associate 33798445
Mitochondrial Diseases Associate 29229477
Myoclonic Epilepsies Progressive Associate 33798445
Neoplasm Metastasis Associate 22180294
Neoplasms Associate 22180294, 22922758
Squamous Cell Carcinoma of Head and Neck Associate 17619081, 22753704
Squamous Cell Carcinoma of Head and Neck Inhibit 19723703