Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10715
Gene name Gene Name - the full gene name approved by the HGNC.
Ceramide synthase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CERS1
Synonyms (NCBI Gene) Gene synonyms aliases
EPM8, GDF-1, GDF1, LAG1, LASS1, UOG1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
EPM8
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a ceramide synthase enzyme, which catalyzes the synthesis of ceramide, the hydrophobic moiety of sphingolipids. The encoded enzyme synthesizes 18-carbon (C18) ceramide in brain neurons. Elevated expression of this gene may be associated
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049351 hsa-miR-92a-3p CLASH 23622248
MIRT048708 hsa-miR-99a-5p CLASH 23622248
MIRT037949 hsa-miR-505-5p CLASH 23622248
MIRT453210 hsa-miR-6784-5p HITS-CLIP 23706177
MIRT453209 hsa-miR-4508 HITS-CLIP 23706177
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IBA 21873635
GO:0005783 Component Endoplasmic reticulum IDA 17699106, 19800881, 24782409
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0016020 Component Membrane TAS 12869556
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606919 14253 ENSG00000223802
Protein
UniProt ID P27544
Protein name Ceramide synthase 1 (CerS1) (LAG1 longevity assurance homolog 1) (Longevity assurance gene 1 protein homolog 1) (Protein UOG-1) (Sphingoid base N-stearoyltransferase CERS1) (EC 2.3.1.299)
Protein function Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward stearoyl-CoA (octadecanoyl-CoA; C18:0-CoA) (PubMed:17977534, PubMed:23530041, PubMed:26887952, PubMed:31916624). N-ac
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03798 TRAM_LAG1_CLN8 98 304 TLC domain Domain
Sequence
MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL
LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL
FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML
LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA
DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL
YIVA
FAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Sequence length 350
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway
  Sphingolipid de novo biosynthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Action myoclonus-renal failure syndrome Action Myoclonus-Renal Failure Syndrome rs727502772, rs727502773, rs121909118, rs121909119, rs727502781, rs727502782, rs200053119, rs886041078, rs886041077, rs886041076, rs886041075, rs995674389, rs1553948516, rs1578733075
Congenital heart defects Congenital Heart Defects, CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 6 rs267607101, rs121434422, rs387906498, rs397509416, rs587777371, rs587777372, rs587777374, rs367537998, rs797044882, rs886041730, rs768027510, rs1064793873, rs1555447012, rs1554263268, rs1554263321
View all (13 more)
Dentatorubral pallidoluysian atrophy Dentatorubral-Pallidoluysian Atrophy rs60216939
Double outlet right ventricle Double Outlet Right Ventricle rs397514520, rs397514521
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 25724183
Coronary Artery Disease Associate 37298446
Endometriosis Associate 35992117
Epileptic Encephalopathy Early Infantile 3 Associate 33798445
Mitochondrial Diseases Associate 29229477
Myoclonic Epilepsies Progressive Associate 33798445
Neoplasm Metastasis Associate 22180294
Neoplasms Associate 22180294, 22922758
Squamous Cell Carcinoma of Head and Neck Associate 17619081, 22753704
Squamous Cell Carcinoma of Head and Neck Inhibit 19723703