Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10686
Gene name Gene Name - the full gene name approved by the HGNC.
Claudin 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLDN16
Synonyms (NCBI Gene) Gene synonyms aliases
HOMG3, PCLN1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
HOMG3
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q28
Summary Summary of gene provided in NCBI Entrez Gene.
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104893720 C>T Pathogenic Stop gained, coding sequence variant
rs104893721 G>A,T Pathogenic Stop gained, missense variant, coding sequence variant
rs104893722 G>A Pathogenic Missense variant, coding sequence variant
rs104893723 G>A,T Pathogenic Missense variant, coding sequence variant
rs104893724 T>C,G Pathogenic Initiator codon variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT649504 hsa-miR-548n HITS-CLIP 23824327
MIRT649503 hsa-miR-548a-5p HITS-CLIP 23824327
MIRT649502 hsa-miR-548ab HITS-CLIP 23824327
MIRT649501 hsa-miR-548ad-5p HITS-CLIP 23824327
MIRT649500 hsa-miR-548ae-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 22373575
GO:0005886 Component Plasma membrane IBA 21873635
GO:0005923 Component Bicellular tight junction IBA 21873635
GO:0005923 Component Bicellular tight junction ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603959 2037 ENSG00000113946
Protein
UniProt ID Q9Y5I7
Protein name Claudin-16 (Paracellin-1) (PCLN-1)
Protein function Forms paracellular channels: coassembles with CLDN19 into tight junction strands with cation-selective channels through the strands, conveying epithelial permeability in a process known as paracellular tight junction permeability (PubMed:1623432
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00822 PMP22_Claudin 72 253 PMP-22/EMP/MP20/Claudin family Family
Tissue specificity TISSUE SPECIFICITY: Kidney-specific, including the thick ascending limb of Henle (TAL). {ECO:0000269|PubMed:10390358}.
Sequence
MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCP
CCHPDGLLATMRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWEC
VTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEP
YIKVRICFVAGATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGM
AGSLGCFLAGAVL
TCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYA
VDTRV
Sequence length 305
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Virion - Hepatitis viruses
Cell adhesion molecules
Tight junction
Leukocyte transendothelial migration
Pathogenic Escherichia coli infection
Hepatitis C
 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Hypercalciuria HYPERCALCIURIA, CHILDHOOD, SELF-LIMITING rs121908542, rs1588844639 11518780, 10878661, 18816383
Hypomagnesemia Hypomagnesemia 2, renal, Primary hypomagnesemia (disorder) rs118203979, rs118203980, rs118203981, rs104893720, rs104893721, rs104893722, rs104893723, rs104893724, rs104893725, rs104893727, rs104893728, rs104893729, rs104893730, rs104893731, rs104893732
View all (90 more)
11518780, 20607983, 10878661, 16234325, 18816383, 15856319, 25477417, 26426912, 27604308, 10390358
Kidney disease Chronic Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Myopia Myopia rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805
View all (6 more)
Associations from Text Mining
Disease Name Relationship Type References
Aortic Coarctation Associate 16924549
Cardiovascular Abnormalities Associate 16924549
Chronic Kidney Disease Mineral and Bone Disorder Associate 22422540, 30005619
Congenital Abnormalities Associate 16924549
Diabetes Mellitus Type 2 Associate 32747424
Epileptic Syndromes Associate 24321194, 30005619, 40428323
FACES syndrome Associate 16924549
Fanconi Syndrome Associate 16924549
Fused Kidney Associate 16924549
Genetic Diseases Inborn Associate 14628289, 16924549