CETN1 (centrin 1)

Gene

• Entrez ID: 1068
• Gene name: Centrin 1
• Gene symbol: CETN1
• Synonyms (NCBI Gene): CEN1, CETN
• Chromosome: 18
• Chromosome location: 18p11.32
• Summary: The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the regio

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022033	hsa-miR-128-3p	Microarray	17612493

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000922	Component	Spindle pole	IDA	8175926
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	20643351, 25416956, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	8175926
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	IMP	18331714
GO:0005814	Component	Centriole	IBA
GO:0005814	Component	Centriole	IDA	18331714, 24421332
GO:0005814	Component	Centriole	IEA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0007099	Process	Centriole replication	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0032391	Component	Photoreceptor connecting cilium	IEA
GO:0032391	Component	Photoreceptor connecting cilium	ISS
GO:0032795	Function	Heterotrimeric G-protein binding	IEA
GO:0034605	Process	Cellular response to heat	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA

Other IDs

• MIM: 603187
• HGNC: 1866
• e!Ensembl: ENSG00000177143

Protein

• UniProt ID: Q12798
• Protein name: Centrin-1 (Caltractin isoform 2)
• Protein function: Plays a fundamental role in microtubule-organizing center structure and function (PubMed:8175926). Plays a role in sperm cilia formation (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13499	EF-hand_7	30 → 94	EF-hand domain pair	Domain
  PF13499	EF-hand_7	103 → 167	EF-hand domain pair	Domain

• Sequence:

  MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRAL
  GFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGK
  ISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

• Sequence length: 172

Pathways

Reactome:

Aggrephagy