Gene Gene information from NCBI Gene database.
Entrez ID 10678
Gene name UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Gene symbol B3GNT2
Synonyms (NCBI Gene)
3-Gn-T13-Gn-T2B3GN-T2B3GNTB3GNT-2B3GNT1BETA3GNTBGNT2BGnT-2beta-1beta3Gn-T1beta3Gn-T2
Chromosome 2
Chromosome location 2p15
Summary This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two
miRNA miRNA information provided by mirtarbase database.
311
miRTarBase ID miRNA Experiments Reference
MIRT022296 hsa-miR-124-3p Microarray 18668037
MIRT023499 hsa-miR-1-3p Microarray 18668037
MIRT303046 hsa-miR-10a-3p PAR-CLIP 20371350
MIRT089117 hsa-miR-5583-3p PAR-CLIP 20371350
MIRT089105 hsa-miR-15a-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 18826941, 33961781
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605581 15629 ENSG00000170340
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NY97
Protein name N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 (EC 2.4.1.149) (Beta-1,3-N-acetylglucosaminyltransferase 1) (BGnT-1) (Beta-1,3-Gn-T1) (Beta3Gn-T1) (Beta-1,3-galactosyltransferase 7) (Beta-1,3-GalTase 7) (Beta3Gal-T7) (Beta3GalT7) (b3Gal-T
Protein function Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Catalyzes the initiation and elongation of poly-N-acetyllactosamine chains. Shows a marked preference for Gal(beta1-4)Glc(NAc)-based acceptors (PubMe
PDB 6WMM , 6WMN , 6WMO , 7JHK , 7JHL , 7JHM , 7JHN , 7JHO , 8SZ3 , 8TIC , 8TJC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01762 Galactosyl_T 156 351 Galactosyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11042166}.
Sequence
MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWN
REQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFL
LYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVF
LLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEF
VFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLY
PPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHK
GFRTFDIEE
KNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC
Sequence length 397
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
  Keratan sulfate biosynthesis
O-linked glycosylation of mucins
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
B3GNT2-related disorder Likely benign; Benign rs144486810, rs547861725, rs530600752, rs72893877 RCV003981563
RCV003974205
RCV003962087
RCV003910380
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 23577190, 23904455
Autoimmune Diseases Associate 23904455
Carcinogenesis Stimulate 35073841
Carcinoma Hepatocellular Associate 25605193
Colonic Neoplasms Associate 27004849
Colorectal Neoplasms Associate 15620693, 27004849
Esophageal Neoplasms Associate 35073841
Genetic Diseases Inborn Associate 33494994
Glioblastoma Associate 27871300
Graves Disease Associate 23904455