Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10675
Gene name	Chondroitin sulfate proteoglycan 5
Gene symbol	CSPG5
Synonyms (NCBI Gene)	NGC
Chromosome	3
Chromosome location	3p21.31
Summary	The protein encoded by this gene is a proteoglycan that may function as a neural growth and differentiation factor. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Show/Hide all (3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029790	hsa-miR-26b-5p	Microarray	19088304
MIRT049719	hsa-miR-92a-3p	CLASH	23622248
MIRT052881	hsa-miR-3691-5p	CLASH	23622248

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	12885772, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	12885772
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9950058
GO:0007010	Process	Cytoskeleton organization	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	12885772
GO:0008083	Function	Growth factor activity	TAS	12885772
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9950058, 12885772
GO:0030154	Process	Cell differentiation	IEA
GO:0030660	Component	Golgi-associated vesicle membrane	IDA	12885772
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046907	Process	Intracellular transport	TAS	12885772
GO:0048858	Process	Cell projection morphogenesis	IBA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0106091	Process	Glial cell projection elongation	ISS
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	ISS
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA

MIM	HGNC	e!Ensembl
606775	2467	ENSG00000114646

O95196

Protein name

Chondroitin sulfate proteoglycan 5 (Acidic leucine-rich EGF-like domain-containing brain protein) (Neuroglycan C)

Protein function

May function as a growth and differentiation factor involved in neuritogenesis. May induce ERBB3 activation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06566	Chon_Sulph_att	33 → 277	Chondroitin sulphate attachment domain	Domain
PF06567	Neural_ProG_Cyt	447 → 565	Neural chondroitin sulphate proteoglycan cytoplasmic domain	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Detected in urine (at protein level) (PubMed:37453717). Expressed in brain (at protein level) (PubMed:9950058). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:3745

Sequence

MGRAGGGGPGRGPPPLLLFLGAALVLASGAVPAREAGSAVEAEELVKGSPAWEPPANDTR
EEAGPPAAGEDEASWTAPGGELAGPEEVLQESAAVTGTAWLEADSPGLGGVTAEAGSGDA
QALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNLG
GSTPDPQGPELTYPFQGTLEPQPASDIIDIDYFEGLDGEGRGADLGSFPGSPGTSENHPD
TEGETPSWSLLDLYDDFTPFDESDFYPTTSFYDDLDEEEEEEEDDKDAVGGGDLEDENEL
LVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSENGTECR
SGFVRHNGSCRSVCDLFPSYCHNGGQCYLVENIGAFCRCNTQDYIWHKGMRCESIITDFQ
VMCVAVGSAALVLLLLFMMTVFFAKKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIA
EGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQN
SMSPKLEGGKGDQADLDVNCLQNNLT

Sequence length

566

Interactions

View interactions

	Reactome
			A tetrasaccharide linker sequence is required for GAG synthesis Chondroitin sulfate biosynthesis Dermatan sulfate biosynthesis CS/DS degradation Defective B4GALT7 causes EDS, progeroid type Defective B3GAT3 causes JDSSDHD Defective CHST3 causes SEDCJD Defective CHST14 causes EDS, musculocontractural type Defective CHSY1 causes TPBS Defective B3GALT6 causes EDSP2 and SEMDJL1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	32579175, 34745496	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	33819196	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Associate	37443739	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	38238671	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ovarian Insufficiency	Associate	24939957	★★★★★ ★☆☆☆☆ Found in Text Mining only

CSPG5 (chondroitin sulfate proteoglycan 5)