CGREF1 (cell growth regulator with EF-hand domain 1)

Gene

• Entrez ID: 10669
• Gene name: Cell growth regulator with EF-hand domain 1
• Gene symbol: CGREF1
• Synonyms (NCBI Gene): CGR11
• Chromosome: 2
• Chromosome location: 2p23.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT888375	hsa-miR-3120-3p	CLIP-seq
MIRT888376	hsa-miR-3912	CLIP-seq
MIRT888377	hsa-miR-448	CLIP-seq
MIRT888378	hsa-miR-105	CLIP-seq
MIRT888379	hsa-miR-22	CLIP-seq
MIRT888375	hsa-miR-3120-3p	CLIP-seq
MIRT888377	hsa-miR-448	CLIP-seq
MIRT888380	hsa-miR-4694-3p	CLIP-seq
MIRT1963372	hsa-miR-1184	CLIP-seq
MIRT1963373	hsa-miR-1205	CLIP-seq
MIRT1963374	hsa-miR-1238	CLIP-seq
MIRT1963375	hsa-miR-3127-5p	CLIP-seq
MIRT1963376	hsa-miR-3158-3p	CLIP-seq
MIRT1963377	hsa-miR-3158-5p	CLIP-seq
MIRT1963378	hsa-miR-331-3p	CLIP-seq
MIRT1963379	hsa-miR-3672	CLIP-seq
MIRT1963380	hsa-miR-3677-3p	CLIP-seq
MIRT1963381	hsa-miR-3679-3p	CLIP-seq
MIRT1963382	hsa-miR-3909	CLIP-seq
MIRT1963383	hsa-miR-3918	CLIP-seq
MIRT1963384	hsa-miR-4329	CLIP-seq
MIRT2199795	hsa-miR-1285	CLIP-seq
MIRT2199796	hsa-miR-141	CLIP-seq
MIRT2199797	hsa-miR-200a	CLIP-seq
MIRT2199798	hsa-miR-3187-5p	CLIP-seq
MIRT2199799	hsa-miR-3937	CLIP-seq
MIRT2199800	hsa-miR-612	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8968090
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	IEA

Other IDs

• MIM: 606137
• HGNC: 16962
• e!Ensembl: ENSG00000138028

Protein

• UniProt ID: Q99674
• Protein name: Cell growth regulator with EF hand domain protein 1 (Cell growth regulatory gene 11 protein) (Hydrophobestin)
• Protein function: Mediates cell-cell adhesion in a calcium-dependent manner (By similarity). Able to inhibit growth in several cell lines.
• Sequence:

  MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGR
  TEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVD
  KVLETQDLNGDGLMTPAELINFPGVALRHVEPGEPLAPSPQEPQAVGRQSLLAKSPLRQE
  TQEAPGPREEAKGQVEARRESLDPVQEPGGQAEADGDVPGPRGEAEGQAEAKGDAPGPRG
  EAGGQAEAEGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGETLESK
  NTQNDFEVHIVQVENDEI

• Sequence length: 318

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinoma Hepatocellular	Associate	40069645
Colorectal Neoplasms	Associate	37370046
Dermatitis Herpetiformis	Associate	22991566
Muscular Atrophy	Associate	25567521
Neoplasms	Stimulate	40069645
Osteosarcoma	Associate	36408691
Prostatic Neoplasms	Associate	35234293