TSBP1 (testis expressed basic protein 1)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10665
Gene name Gene Name - the full gene name approved by the HGNC.
Testis expressed basic protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSBP1
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf10, TSBP
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus HDA 21630459
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
618151 13922 ENSG00000204296
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5SRN2
Protein name Testis-expressed basic protein 1 (Uncharacterized protein C6orf10)
Family and domains
Sequence 
MTVLEITLAVILTLLGLAILAILLTRWARCKQSEMYISRYSSEQSARLLDYEDGRGSRHA
YSTQSDTSYDNRERSKRDYTPSTNSLVSMASKFSLGQTELILLLMCFILALSRSSIGSIK
CLQTTEEPPSRTAGAMMQFTAPIPGATGPIKLSQKTIVQTPGPIVQYPGSNAGPPSAPRG
PPMAPIIISQRTARIPQVHTMDSSGKITLTPVVILTGYMDEELAKKSCSKIQILKCGGTA
RSQNSREENKEALKNDIIFTNSVESLKSAHIKEPEREGKGTDLEKDKIGMEVKVDSDAGI
PKRQETQLKISEMSIPQGQGAQIKKSVSDVPRGQESQVKKSESGVPKGQEAQVTKSGLVV
LKGQEAQVEKSEMGVPRRQESQVKKSQSGVSKGQEAQVKKRESVVLKGQEAQVEKSELKV
PKGQEGQVEKTEADVPKEQEVQEKKSEAGVLKGPESQVKNTEVSVPETLESQVKKSESGV
LKGQEAQEKKESFEDKGNNDKEKERDAEKDPNKKEKGDKNTKGDKGKDKVKGKRESEING
EKSKGSKRAKANTGRKYNKKVEE
Sequence length 563
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (32)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alopecia Areata Alopecia areata N/A N/A GWAS
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease, Alzheimer's disease or gastroesophageal reflux disease N/A N/A GWAS
Asthma Adult asthma, Asthma, Asthma (childhood onset), Nonatopic asthma, Atopic asthma N/A N/A GWAS
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 27508393
Azoospermia Nonobstructive Associate 22541561
Carcinoma Non Small Cell Lung Associate 32723974
Diabetes Mellitus Type 2 Associate 27508393
Hypertension Associate 32854392
Neonatal Systemic lupus erythematosus Associate 20662065, 22031281
Polymyalgia Rheumatica Associate 27109359
Vitiligo Associate 21326295