Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10660
Gene name Gene Name - the full gene name approved by the HGNC.
Ladybird homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LBX1
Synonyms (NCBI Gene) Gene synonyms aliases
CCHS3, HPX-6, HPX6, LBX1H, homeobox
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CCHS3
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal id
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT488375 hsa-miR-4695-5p PAR-CLIP 20371350
MIRT488372 hsa-miR-6087 PAR-CLIP 20371350
MIRT488369 hsa-miR-765 PAR-CLIP 20371350
MIRT488368 hsa-miR-7106-5p PAR-CLIP 20371350
MIRT569361 hsa-miR-6781-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001947 Process Heart looping IEA
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604255 16960 ENSG00000138136
Protein
UniProt ID P52954
Protein name Transcription factor LBX1 (Ladybird homeobox protein homolog 1)
Protein function Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord. {ECO:000
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 126 182 Homeodomain Domain
Sequence
MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLL
AAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ
TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL
KR
DLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPG
APKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD
Sequence length 281
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
19651985
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
19651985
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
19651985
Scoliosis Scoliosis, unspecified rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085 22019779
Unknown
Disease term Disease name Evidence References Source
Uterine Fibroids Uterine Fibroids GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Neoplasms Associate 15579438
Scoliosis Associate 36140724
Somatosensory Disorders Associate 23308168