Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	10660
Gene name	Ladybird homeobox 1
Gene symbol	LBX1
Synonyms (NCBI Gene)	CCHS3HPX-6HPX6LBX1Hhomeobox
Chromosome	10
Chromosome location	10q24.32
Summary	This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal id

Show/Hide all (54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT488375	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT488372	hsa-miR-6087	PAR-CLIP	20371350
MIRT488369	hsa-miR-765	PAR-CLIP	20371350
MIRT488368	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569361	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT488366	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569360	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT569359	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT569358	hsa-miR-8089	PAR-CLIP	20371350
MIRT488374	hsa-miR-4715-5p	PAR-CLIP	20371350
MIRT488373	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT488372	hsa-miR-6087	PAR-CLIP	20371350
MIRT488371	hsa-miR-571	PAR-CLIP	20371350
MIRT488370	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT488367	hsa-miR-7150	PAR-CLIP	20371350
MIRT488365	hsa-miR-6865-5p	PAR-CLIP	20371350
MIRT488375	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT488374	hsa-miR-4715-5p	PAR-CLIP	23592263
MIRT488373	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT488372	hsa-miR-6087	PAR-CLIP	23592263
MIRT488371	hsa-miR-571	PAR-CLIP	23592263
MIRT488370	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT488369	hsa-miR-765	PAR-CLIP	23592263
MIRT488368	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT488366	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT488367	hsa-miR-7150	PAR-CLIP	23592263
MIRT488365	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT488375	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT488372	hsa-miR-6087	PAR-CLIP	20371350
MIRT488369	hsa-miR-765	PAR-CLIP	20371350
MIRT488368	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569361	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT488366	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569360	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT569359	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT569358	hsa-miR-8089	PAR-CLIP	20371350
MIRT488374	hsa-miR-4715-5p	PAR-CLIP	20371350
MIRT488373	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT488372	hsa-miR-6087	PAR-CLIP	20371350
MIRT488371	hsa-miR-571	PAR-CLIP	20371350
MIRT488370	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT488367	hsa-miR-7150	PAR-CLIP	20371350
MIRT488365	hsa-miR-6865-5p	PAR-CLIP	20371350
MIRT488375	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT488374	hsa-miR-4715-5p	PAR-CLIP	23592263
MIRT488373	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT488372	hsa-miR-6087	PAR-CLIP	23592263
MIRT488371	hsa-miR-571	PAR-CLIP	23592263
MIRT488370	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT488369	hsa-miR-765	PAR-CLIP	23592263
MIRT488368	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT488366	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT488367	hsa-miR-7150	PAR-CLIP	23592263
MIRT488365	hsa-miR-6865-5p	PAR-CLIP	23592263

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001947	Process	Heart looping	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 36217029
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	8645601
GO:0021522	Process	Spinal cord motor neuron differentiation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048664	Process	Neuron fate determination	IEA
GO:0120007	Process	Negative regulation of glutamatergic neuron differentiation	IEA
GO:1905962	Process	Glutamatergic neuron differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IBA

MIM	HGNC	e!Ensembl
604255	16960	ENSG00000138136

P52954

Protein name

Transcription factor LBX1 (Ladybird homeobox protein homolog 1)

Protein function

Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord. {ECO:000

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	126 → 182	Homeodomain	Domain

Sequence

MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLL
AAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ
TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL
KRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPG
APKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD

Sequence length

281

Interactions

View interactions

LBX1 (ladybird homeobox 1)