Gene Gene information from NCBI Gene database.
Entrez ID 10659
Gene name CUGBP Elav-like family member 2
Gene symbol CELF2
Synonyms (NCBI Gene)
BRUNOL3CELF-2CUG-BP2CUGBP2DEE97ETR-3ETR3NAPOR
Chromosome 10
Chromosome location 10p14
Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mR
miRNA miRNA information provided by mirtarbase database.
507
miRTarBase ID miRNA Experiments Reference
MIRT016668 hsa-miR-425-5p Sequencing 20371350
MIRT020050 hsa-miR-375 Microarray 20215506
MIRT051430 hsa-let-7e-5p CLASH 23622248
MIRT043173 hsa-miR-324-5p CLASH 23622248
MIRT054423 hsa-miR-95-3p Luciferase reporter assayqRT-PCRWestern blot 24530415
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IEA
GO:0003723 Function RNA binding TAS 9887331
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602538 2550 ENSG00000048740
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95319
Protein name CUGBP Elav-like family member 2 (CELF-2) (Bruno-like protein 3) (CUG triplet repeat RNA-binding protein 2) (CUG-BP2) (CUG-BP- and ETR-3-like factor 2) (ELAV-type RNA-binding protein 3) (ETR-3) (Neuroblastoma apoptosis-related RNA-binding protein) (hNAPOR)
Protein function RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-s
PDB 2MY7 , 2MY8 , 4LJM , 4LMZ , 4TLQ , 5M8I
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 42 113 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 134 202 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 425 495 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in frontal cortex. Isoform 1 is expressed in brain and lung. Isoform 2 is expressed in heart, brain, placenta, lung, liver, kidney, skeletal muscle and pancreas. Isoform 4 is expressed in heart, lung, skeletal muscle, kidney
Sequence
MRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELF
EPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMH
HPIQMKP
ADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFS
TRAMAQNAIKAMHQSQTMEGCS
SPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNL
TGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATST
NANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAGM
AALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGP
EGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAA
IQAMNGFQIGMKRLK
VQLKRSKNDSKPY
Sequence length 508
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
22
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
CELF2-related disorder Likely pathogenic rs201674366 RCV003969575
Developmental and epileptic encephalopathy 97 Likely pathogenic; Pathogenic rs2138616482, rs2132786780, rs2132785331, rs2132786873, rs2132785456, rs2132555667 RCV002287501
RCV001728161
RCV001728162
RCV001728163
RCV001814914
RCV002249339
Neurodevelopmental disorder Likely pathogenic; Pathogenic rs2138616482 RCV006249757
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 21379329
Breast Neoplasms Associate 31409895, 33461604, 34288370
Carcinoma Hepatocellular Associate 32271415, 32826865
Carcinoma Squamous Cell Associate 34288370
Colorectal Neoplasms Associate 18292181, 36727289
Death Associate 26314850
Dementia Associate 35327643
Glioma Associate 30268547
Hypoxia Inhibit 33969722
Leukemia Myeloid Associate 33439746