Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10645
Gene name Gene Name - the full gene name approved by the HGNC.
Calcium/calmodulin dependent protein kinase kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CAMKK2
Synonyms (NCBI Gene) Gene synonyms aliases
CAMKK, CAMKKB
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosph
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027179 hsa-miR-103a-3p Sequencing 20371350
MIRT031851 hsa-miR-16-5p Sequencing 20371350
MIRT048541 hsa-miR-100-5p CLASH 23622248
MIRT045326 hsa-miR-185-5p CLASH 23622248
MIRT688870 hsa-miR-6854-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS 11395482
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0004674 Function Protein serine/threonine kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615002 1470 ENSG00000110931
Protein
UniProt ID Q96RR4
Protein name Calcium/calmodulin-dependent protein kinase kinase 2 (CaM-KK 2) (CaM-kinase kinase 2) (CaMKK 2) (EC 2.7.11.17) (Calcium/calmodulin-dependent protein kinase kinase beta) (CaM-KK beta) (CaM-kinase kinase beta) (CaMKK beta)
Protein function Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D
PDB 2ZV2 , 5UY6 , 5UYJ , 5VT1 , 5YV8 , 5YV9 , 5YVA , 5YVB , 5YVC , 6BKU , 6BLE , 6BQL , 6BQP , 6BQQ , 6BRC , 6CMJ , 6EF5 , 6EWW , 6FEL , 6Y3O , 6Y4K , 6Y6B , 6Y8A , 8TUC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 165 446 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed with higher levels in the brain. Intermediate levels are detected in spleen, prostate, thyroid and leukocytes. The lowest level is in lung. {ECO:0000269|PubMed:9662074}.
Sequence
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWV
TRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
Sequence length 588
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Autophagy - animal
AMPK signaling pathway
Longevity regulating pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Alcoholic liver disease
Alcoholism
  CaMK IV-mediated phosphorylation of CREB
CREB1 phosphorylation through the activation of CaMKII/CaMKK/CaMKIV cascasde
Activation of RAC1 downstream of NMDARs
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Type 2 diabetes mellitus or coronary artery disease (pleiotropy) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abidi X linked mental retardation syndrome Associate 28737528
AIDS Associated Nephropathy Associate 37166584
Alopecia Associate 35438341
Anxiety Associate 33082841
Bipolar Disorder Associate 33082841
Breast Neoplasms Associate 37661833
Carcinogenesis Associate 34725334
Cerebral Infarction Associate 22662160
Cholangiocarcinoma Associate 38082327
Cystic Fibrosis Associate 24859760