Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10644
Gene name	Insulin like growth factor 2 mRNA binding protein 2
Gene symbol	IGF2BP2
Synonyms (NCBI Gene)	IMP-2IMP2VICKZ2
Chromosome	3
Chromosome location	3q27.2
Summary	This gene encodes a protein that binds the 5` UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative spl

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs4402960	G>T	Risk-factor	Intron variant, genic upstream transcript variant

158

Show/Hide all (158)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000792	hsa-miR-18a-5p	MicroarrayNorthern blot	16331254
MIRT005241	hsa-let-7b-5p	pSILAC	18668040
MIRT018969	hsa-miR-335-5p	Microarray	18185580
MIRT027853	hsa-miR-98-5p	Microarray	19088304
MIRT005241	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT043535	hsa-miR-331-3p	CLASH	23622248
MIRT043535	hsa-miR-331-3p	CLASH	23622248
MIRT038642	hsa-miR-125a-3p	CLASH	23622248
MIRT037361	hsa-miR-877-5p	CLASH	23622248
MIRT005241	hsa-let-7b-5p	ImmunohistochemistryLuciferase reporter assayQRTPCRWestern blot	23482325
MIRT674545	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT674544	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT674545	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT674544	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT005241	hsa-let-7b-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)	38443392
MIRT1061981	hsa-miR-1256	CLIP-seq
MIRT1061982	hsa-miR-204	CLIP-seq
MIRT1061983	hsa-miR-211	CLIP-seq
MIRT1061984	hsa-miR-323-5p	CLIP-seq
MIRT1061985	hsa-miR-329	CLIP-seq
MIRT1061986	hsa-miR-362-3p	CLIP-seq
MIRT1061987	hsa-miR-3941	CLIP-seq
MIRT1061988	hsa-miR-4263	CLIP-seq
MIRT1061989	hsa-miR-4299	CLIP-seq
MIRT1061990	hsa-miR-4456	CLIP-seq
MIRT1061991	hsa-miR-4496	CLIP-seq
MIRT1061992	hsa-miR-4517	CLIP-seq
MIRT1061993	hsa-miR-4643	CLIP-seq
MIRT1061994	hsa-miR-4720-5p	CLIP-seq
MIRT1061995	hsa-miR-4738-3p	CLIP-seq
MIRT1061996	hsa-miR-4755-5p	CLIP-seq
MIRT1061997	hsa-miR-4799-3p	CLIP-seq
MIRT1061998	hsa-miR-548c-3p	CLIP-seq
MIRT1061999	hsa-miR-548q	CLIP-seq
MIRT1062000	hsa-miR-576-5p	CLIP-seq
MIRT1062001	hsa-miR-603	CLIP-seq
MIRT1062002	hsa-miR-622	CLIP-seq
MIRT1062003	hsa-miR-623	CLIP-seq
MIRT1062004	hsa-miR-876-3p	CLIP-seq
MIRT1921358	hsa-miR-2116	CLIP-seq
MIRT1921359	hsa-miR-3659	CLIP-seq
MIRT1921360	hsa-miR-3667-3p	CLIP-seq
MIRT1921361	hsa-miR-4273	CLIP-seq
MIRT1921362	hsa-miR-4446-5p	CLIP-seq
MIRT1921363	hsa-miR-4522	CLIP-seq
MIRT1921364	hsa-miR-4658	CLIP-seq
MIRT1921365	hsa-miR-4677-5p	CLIP-seq
MIRT1061996	hsa-miR-4755-5p	CLIP-seq
MIRT1921366	hsa-miR-574-5p	CLIP-seq
MIRT1921367	hsa-miR-642a	CLIP-seq
MIRT2014650	hsa-miR-4698	CLIP-seq
MIRT2014651	hsa-miR-548aa	CLIP-seq
MIRT2437723	hsa-miR-4672	CLIP-seq
MIRT2437724	hsa-miR-552	CLIP-seq
MIRT2437725	hsa-miR-640	CLIP-seq
MIRT2550464	hsa-miR-1206	CLIP-seq
MIRT1061981	hsa-miR-1256	CLIP-seq
MIRT2550465	hsa-miR-1262	CLIP-seq
MIRT2550466	hsa-miR-135a	CLIP-seq
MIRT2550467	hsa-miR-135b	CLIP-seq
MIRT1061984	hsa-miR-323-5p	CLIP-seq
MIRT2550468	hsa-miR-326	CLIP-seq
MIRT2550469	hsa-miR-330-5p	CLIP-seq
MIRT2550470	hsa-miR-34a	CLIP-seq
MIRT2550471	hsa-miR-34c-5p	CLIP-seq
MIRT1921359	hsa-miR-3659	CLIP-seq
MIRT1921360	hsa-miR-3667-3p	CLIP-seq
MIRT2550472	hsa-miR-3925-3p	CLIP-seq
MIRT1061989	hsa-miR-4299	CLIP-seq
MIRT1921362	hsa-miR-4446-5p	CLIP-seq
MIRT1061990	hsa-miR-4456	CLIP-seq
MIRT2550473	hsa-miR-449a	CLIP-seq
MIRT2550474	hsa-miR-449b	CLIP-seq
MIRT2550475	hsa-miR-4634	CLIP-seq
MIRT2550476	hsa-miR-4645-5p	CLIP-seq
MIRT1921364	hsa-miR-4658	CLIP-seq
MIRT2550477	hsa-miR-4666-5p	CLIP-seq
MIRT2437723	hsa-miR-4672	CLIP-seq
MIRT2550478	hsa-miR-4673	CLIP-seq
MIRT2550479	hsa-miR-4701-3p	CLIP-seq
MIRT2550480	hsa-miR-4712-5p	CLIP-seq
MIRT1061996	hsa-miR-4755-5p	CLIP-seq
MIRT2550481	hsa-miR-4793-5p	CLIP-seq
MIRT2550482	hsa-miR-501-5p	CLIP-seq
MIRT2550483	hsa-miR-515-5p	CLIP-seq
MIRT1061999	hsa-miR-548q	CLIP-seq
MIRT2437724	hsa-miR-552	CLIP-seq
MIRT1921366	hsa-miR-574-5p	CLIP-seq
MIRT1062002	hsa-miR-622	CLIP-seq
MIRT2437725	hsa-miR-640	CLIP-seq
MIRT1921367	hsa-miR-642a	CLIP-seq
MIRT2550484	hsa-miR-652	CLIP-seq
MIRT2550485	hsa-miR-766	CLIP-seq
MIRT2550486	hsa-miR-770-5p	CLIP-seq
MIRT1062004	hsa-miR-876-3p	CLIP-seq
MIRT2550464	hsa-miR-1206	CLIP-seq
MIRT2682649	hsa-miR-1238	CLIP-seq
MIRT1061981	hsa-miR-1256	CLIP-seq
MIRT2550465	hsa-miR-1262	CLIP-seq
MIRT2550466	hsa-miR-135a	CLIP-seq
MIRT2550467	hsa-miR-135b	CLIP-seq
MIRT2682650	hsa-miR-147b	CLIP-seq
MIRT2682651	hsa-miR-150	CLIP-seq
MIRT2682652	hsa-miR-210	CLIP-seq
MIRT2682653	hsa-miR-2113	CLIP-seq
MIRT1921358	hsa-miR-2116	CLIP-seq
MIRT2682654	hsa-miR-3183	CLIP-seq
MIRT1061984	hsa-miR-323-5p	CLIP-seq
MIRT2550468	hsa-miR-326	CLIP-seq
MIRT2682655	hsa-miR-330-3p	CLIP-seq
MIRT2550469	hsa-miR-330-5p	CLIP-seq
MIRT2550470	hsa-miR-34a	CLIP-seq
MIRT2550471	hsa-miR-34c-5p	CLIP-seq
MIRT2682656	hsa-miR-3621	CLIP-seq
MIRT2682657	hsa-miR-3656	CLIP-seq
MIRT1921359	hsa-miR-3659	CLIP-seq
MIRT1921360	hsa-miR-3667-3p	CLIP-seq
MIRT2550472	hsa-miR-3925-3p	CLIP-seq
MIRT2682658	hsa-miR-4268	CLIP-seq
MIRT1921361	hsa-miR-4273	CLIP-seq
MIRT1061989	hsa-miR-4299	CLIP-seq
MIRT2682659	hsa-miR-4428	CLIP-seq
MIRT1921362	hsa-miR-4446-5p	CLIP-seq
MIRT1061990	hsa-miR-4456	CLIP-seq
MIRT2682660	hsa-miR-4477a	CLIP-seq
MIRT2550473	hsa-miR-449a	CLIP-seq
MIRT2550474	hsa-miR-449b	CLIP-seq
MIRT1921363	hsa-miR-4522	CLIP-seq
MIRT2550475	hsa-miR-4634	CLIP-seq
MIRT2550476	hsa-miR-4645-5p	CLIP-seq
MIRT1921364	hsa-miR-4658	CLIP-seq
MIRT2550477	hsa-miR-4666-5p	CLIP-seq
MIRT2437723	hsa-miR-4672	CLIP-seq
MIRT2550478	hsa-miR-4673	CLIP-seq
MIRT1921365	hsa-miR-4677-5p	CLIP-seq
MIRT2682661	hsa-miR-4684-5p	CLIP-seq
MIRT2550479	hsa-miR-4701-3p	CLIP-seq
MIRT2550480	hsa-miR-4712-5p	CLIP-seq
MIRT2682662	hsa-miR-4723-3p	CLIP-seq
MIRT1061996	hsa-miR-4755-5p	CLIP-seq
MIRT2682663	hsa-miR-4757-5p	CLIP-seq
MIRT2682664	hsa-miR-4786-5p	CLIP-seq
MIRT2550481	hsa-miR-4793-5p	CLIP-seq
MIRT2682665	hsa-miR-4797-5p	CLIP-seq
MIRT2550482	hsa-miR-501-5p	CLIP-seq
MIRT2550483	hsa-miR-515-5p	CLIP-seq
MIRT1061999	hsa-miR-548q	CLIP-seq
MIRT2682666	hsa-miR-548u	CLIP-seq
MIRT2437724	hsa-miR-552	CLIP-seq
MIRT1921366	hsa-miR-574-5p	CLIP-seq
MIRT1062002	hsa-miR-622	CLIP-seq
MIRT2437725	hsa-miR-640	CLIP-seq
MIRT1921367	hsa-miR-642a	CLIP-seq
MIRT2550484	hsa-miR-652	CLIP-seq
MIRT2550485	hsa-miR-766	CLIP-seq
MIRT2682667	hsa-miR-769-5p	CLIP-seq
MIRT2550486	hsa-miR-770-5p	CLIP-seq
MIRT1062004	hsa-miR-876-3p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HMGA2	Unknown	17426251;22513850
NFKB1	Unknown	17426251
RELA	Unknown	17426251

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	29476152
GO:0000932	Component	P-body	IEA
GO:0001817	Process	Regulation of cytokine production	IC	9891060
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0003730	Function	MRNA 3'-UTR binding	IDA	20080952
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005515	Function	Protein binding	IPI	12674497, 17289661, 31484925, 32814053, 34457052, 36950384
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15618018
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15618018
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	15618018
GO:0006417	Process	Regulation of translation	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9891060
GO:0010494	Component	Cytoplasmic stress granule	IDA	29476152
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0017148	Process	Negative regulation of translation	ISS	9891060
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	36354136
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	36354136
GO:0043489	Process	RNA stabilization	IMP	36354136
GO:0045182	Function	Translation regulator activity	IEA
GO:0045182	Function	Translation regulator activity	ISS	9891060
GO:0048027	Function	MRNA 5'-UTR binding	IDA	9891060
GO:0048027	Function	MRNA 5'-UTR binding	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0070934	Process	CRD-mediated mRNA stabilization	IBA
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	29476152
GO:0070934	Process	CRD-mediated mRNA stabilization	IEA
GO:0097009	Process	Energy homeostasis	IEA
GO:0106106	Process	Cold-induced thermogenesis	IEA
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IDA	29476152, 32245947, 36354136
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IEA

MIM	HGNC	e!Ensembl
608289	28867	ENSG00000073792

Q9Y6M1

Protein name

Insulin-like growth factor 2 mRNA-binding protein 2 (IGF2 mRNA-binding protein 2) (IMP-2) (Hepatocellular carcinoma autoantigen p62) (IGF-II mRNA-binding protein 2) (VICKZ family member 2)

Protein function

RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcript

PDB

2CQH , 6ROL , 7Q98 , 7Q99

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	5 → 69	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	84 → 151	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00013	KH_1	195 → 260	KH domain	Domain
PF00013	KH_1	276 → 343	KH domain	Domain
PF00013	KH_1	429 → 494	KH domain	Domain
PF00013	KH_1	511 → 577	KH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in oocytes, granulosa cells of small and growing follicles, Leydig cells, spermatogonia and semen (at protein level). Expressed in testicular cancer (at protein level). Expressed weakly in heart, placenta, skeletal muscle, bo

Sequence

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSG
KVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTET
AVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQG
HAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEK
PVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKI
EHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQA
NLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITG
PPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTS
AEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK

Sequence length

599

Interactions

View interactions

	Reactome
			Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs) bind RNA

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Diabetes mellitus type 2, susceptibility to	risk factor	rs4402960	RCV000002537

Show/Hide Text Mining Associations (81)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Stimulate	27391348
Adenocarcinoma	Associate	30335898
Adenocarcinoma of Lung	Associate	27903974, 35011587, 35343834, 37353784
Alzheimer Disease	Stimulate	34705667
Autoimmune Diseases	Associate	23421499, 25721883
Breast Neoplasms	Associate	25721883, 26416451, 27733218
Breast Neoplasms	Stimulate	40137853
Carcinogenesis	Associate	32784624, 38250159
Carcinogenesis	Stimulate	40084251
Carcinoma Hepatocellular	Associate	25741595, 26137588, 27391348, 36289466, 36933158, 37985379, 38287808, 38320625
Carcinoma Non Small Cell Lung	Associate	36257938
Carcinoma Pancreatic Ductal	Associate	31261900, 34061869, 35526050
Carcinoma Renal Cell	Associate	33628845, 34420511, 35876041, 37065178
Carcinoma Squamous Cell	Associate	27903974
Cognitive Dysfunction	Associate	38065904
Colorectal Neoplasms	Associate	21172019, 23421499, 32070145, 35014946, 35595748, 35773744, 36230970, 37194014, 37248468, 37986103, 38287808
Colorectal Neoplasms	Stimulate	27153315, 34659267
Cystic Fibrosis	Associate	23670970
Depressive Disorder	Associate	29280852
Diabetes Gestational	Associate	22096510, 23364967, 33953693, 34928995, 36313769
Diabetes Mellitus	Associate	17463249, 18544707, 19008344, 23029108, 23403707, 23670970, 24932614, 33479058
Diabetes Mellitus Insulin Dependent 19	Associate	22569928
Diabetes Mellitus Type 1	Associate	36457997
Diabetes Mellitus Type 2	Associate	17463248, 17463249, 18426861, 18461161, 18469204, 18598350, 18633108, 18694974, 19008344, 19020324, 19033397, 19148120, 19228808, 19258437, 19401414 View all (30 more)
Diabetes Mellitus Type 2	Stimulate	33390804
Diabetic Nephropathies	Associate	37744330
Endometrial Neoplasms	Associate	34347888
Esophageal Neoplasms	Stimulate	27391348
Esophageal Neoplasms	Associate	34022433
Esophageal Squamous Cell Carcinoma	Associate	27391348, 34022433, 36510377, 36522683
Fetal Nutrition Disorders	Associate	19258437
Fibrosis	Associate	37744330
Glioblastoma	Stimulate	25719943
Glioblastoma	Associate	27184842
Glioma	Associate	32713259, 34432221
Glucose Intolerance	Associate	19258437, 24062323
Head and Neck Neoplasms	Stimulate	38250159
Hypertension	Associate	23403707, 24959828
Hypoglycemia	Associate	18633108
Inflammation	Associate	27391348
Insulin Resistance	Associate	19148120, 23403707, 32784624, 33390804, 34872092
Leukemia	Associate	36306790, 36608677
Leukemia Myeloid Acute	Stimulate	30513526, 37060505
Leukemia Myeloid Acute	Associate	36306790
Lung Diseases	Associate	38287808
Lung Neoplasms	Stimulate	36257938
Lymphatic Metastasis	Associate	32784624, 35919812
Lymphoma B Cell Marginal Zone	Associate	36095303
Lymphoma Large B Cell Diffuse	Associate	35894142
Melanoma	Associate	35707044
Meningioma	Inhibit	37910780
Metabolic Syndrome	Associate	20627640, 23418049, 24959828, 34093434
Mohr Tranebjaerg syndrome	Associate	36354205
Mouth Neoplasms	Associate	32784624, 38250159
Neoplasm Metastasis	Associate	27391348, 35595748, 36522683, 37353784, 38250159
Neoplasm Metastasis	Stimulate	40084251
Neoplasms	Stimulate	25719943, 27391348, 38287808
Neoplasms	Associate	25721883, 26416451, 27184842, 29089486, 30513526, 31261900, 32784624, 33082301, 35502827, 35894142, 36322753, 36416324, 36569935, 37248468, 37353784, 37865637, 37983610 View all (2 more)
Neoplasms	Inhibit	36281789, 39174693
Neoplasms Adipose Tissue	Associate	19148120, 34872092
Neuroblastoma	Associate	32176634
Obesity	Associate	18469204, 23403707, 24062323, 25062844, 25612568, 33487124, 38065904
Osteosarcoma	Associate	33754909, 33952279
Ovarian Neoplasms	Associate	24872956, 38025760
Ovarian Neoplasms	Stimulate	38084732
Overweight	Associate	24959828
Pancreatic Neoplasms	Associate	31261900, 33082301, 34332578, 37858219, 38330578
Pancreatic Neoplasms	Stimulate	33246429
Polycystic Ovary Syndrome	Associate	35293050
Pre Eclampsia	Associate	29339719
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	37820824
Prostatic Neoplasms	Associate	20142250, 27700103, 40084251
Squamous Cell Carcinoma of Head and Neck	Associate	32784624, 35129592, 35689537, 35919812, 36281789, 36416324, 37615536, 38250159, 39174693
Stomach Neoplasms	Associate	33824282, 35502827, 37865637
Tarlov Cysts	Associate	40084251
Tertiary Lymphoid Structures	Associate	30335898
Thyroid Neoplasms	Associate	37726690
Triple Negative Breast Neoplasms	Associate	37983610, 40137853
Urinary Bladder Neoplasms	Associate	35894701, 36569935
Uterine Cervical Neoplasms	Associate	36354205
Uveal melanoma	Associate	36003405

IGF2BP2 (insulin like growth factor 2 mRNA binding protein 2)