Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10630
Gene name Gene Name - the full gene name approved by the HGNC.	Podoplanin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PDPN
Synonyms (NCBI Gene) Gene synonyms aliases	AGGRUS, D2-40, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a di

Show/Hide all(157)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007320	hsa-miR-363-3p	Luciferase reporter assay	23246488
MIRT007320	hsa-miR-363-3p	Luciferase reporter assay	23246488
MIRT007320	hsa-miR-363-3p	Luciferase reporter assay	23246488
MIRT667012	hsa-miR-302f	HITS-CLIP	23706177
MIRT667009	hsa-miR-4695-5p	HITS-CLIP	23706177
MIRT667008	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT667007	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT667006	hsa-miR-940	HITS-CLIP	23706177
MIRT667005	hsa-miR-3929	HITS-CLIP	23706177
MIRT667004	hsa-miR-4419b	HITS-CLIP	23706177
MIRT667003	hsa-miR-4478	HITS-CLIP	23706177
MIRT667001	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT667000	hsa-miR-4459	HITS-CLIP	23706177
MIRT666997	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT666996	hsa-miR-219b-3p	HITS-CLIP	23706177
MIRT666994	hsa-miR-1827	HITS-CLIP	23706177
MIRT666993	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT666992	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT666991	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT666990	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT666989	hsa-miR-3140-3p	HITS-CLIP	23706177
MIRT666987	hsa-miR-514a-3p	HITS-CLIP	23706177
MIRT666986	hsa-miR-514b-3p	HITS-CLIP	23706177
MIRT666985	hsa-miR-665	HITS-CLIP	23706177
MIRT667012	hsa-miR-302f	HITS-CLIP	23824327
MIRT667011	hsa-miR-512-5p	HITS-CLIP	23824327
MIRT667010	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT667009	hsa-miR-4695-5p	HITS-CLIP	23824327
MIRT667008	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT667007	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT667006	hsa-miR-940	HITS-CLIP	23824327
MIRT667005	hsa-miR-3929	HITS-CLIP	23824327
MIRT667004	hsa-miR-4419b	HITS-CLIP	23824327
MIRT667003	hsa-miR-4478	HITS-CLIP	23824327
MIRT667002	hsa-miR-5690	HITS-CLIP	23824327
MIRT667001	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT667000	hsa-miR-4459	HITS-CLIP	23824327
MIRT666999	hsa-miR-4433a-3p	HITS-CLIP	23824327
MIRT666998	hsa-miR-3664-3p	HITS-CLIP	23824327
MIRT666997	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT666996	hsa-miR-219b-3p	HITS-CLIP	23824327
MIRT666995	hsa-miR-3913-3p	HITS-CLIP	23824327
MIRT666994	hsa-miR-1827	HITS-CLIP	23824327
MIRT666993	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT666992	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT666991	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT666990	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT666989	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT666988	hsa-miR-489-3p	HITS-CLIP	23824327
MIRT666987	hsa-miR-514a-3p	HITS-CLIP	23824327
MIRT666986	hsa-miR-514b-3p	HITS-CLIP	23824327
MIRT666985	hsa-miR-665	HITS-CLIP	23824327
MIRT667012	hsa-miR-302f	HITS-CLIP	23706177
MIRT667009	hsa-miR-4695-5p	HITS-CLIP	23706177
MIRT667008	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT667007	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT667006	hsa-miR-940	HITS-CLIP	23706177
MIRT667005	hsa-miR-3929	HITS-CLIP	23706177
MIRT667004	hsa-miR-4419b	HITS-CLIP	23706177
MIRT667003	hsa-miR-4478	HITS-CLIP	23706177
MIRT667001	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT667000	hsa-miR-4459	HITS-CLIP	23706177
MIRT666997	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT666996	hsa-miR-219b-3p	HITS-CLIP	23706177
MIRT666994	hsa-miR-1827	HITS-CLIP	23706177
MIRT666993	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT666992	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT666991	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT666990	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT666989	hsa-miR-3140-3p	HITS-CLIP	23706177
MIRT666987	hsa-miR-514a-3p	HITS-CLIP	23706177
MIRT666986	hsa-miR-514b-3p	HITS-CLIP	23706177
MIRT666985	hsa-miR-665	HITS-CLIP	23706177
MIRT667012	hsa-miR-302f	HITS-CLIP	23824327
MIRT667011	hsa-miR-512-5p	HITS-CLIP	23824327
MIRT667010	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT667009	hsa-miR-4695-5p	HITS-CLIP	23824327
MIRT667008	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT667007	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT667006	hsa-miR-940	HITS-CLIP	23824327
MIRT667005	hsa-miR-3929	HITS-CLIP	23824327
MIRT667004	hsa-miR-4419b	HITS-CLIP	23824327
MIRT667003	hsa-miR-4478	HITS-CLIP	23824327
MIRT667002	hsa-miR-5690	HITS-CLIP	23824327
MIRT667001	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT667000	hsa-miR-4459	HITS-CLIP	23824327
MIRT666999	hsa-miR-4433a-3p	HITS-CLIP	23824327
MIRT666998	hsa-miR-3664-3p	HITS-CLIP	23824327
MIRT666997	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT666996	hsa-miR-219b-3p	HITS-CLIP	23824327
MIRT666995	hsa-miR-3913-3p	HITS-CLIP	23824327
MIRT666994	hsa-miR-1827	HITS-CLIP	23824327
MIRT666993	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT666992	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT666991	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT666990	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT666989	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT666988	hsa-miR-489-3p	HITS-CLIP	23824327
MIRT666987	hsa-miR-514a-3p	HITS-CLIP	23824327
MIRT666986	hsa-miR-514b-3p	HITS-CLIP	23824327
MIRT666985	hsa-miR-665	HITS-CLIP	23824327
MIRT755622	hsa-miR-532-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34939978
MIRT1222839	hsa-miR-1185	CLIP-seq
MIRT1222840	hsa-miR-1252	CLIP-seq
MIRT1222841	hsa-miR-1265	CLIP-seq
MIRT1222842	hsa-miR-197	CLIP-seq
MIRT1222843	hsa-miR-25	CLIP-seq
MIRT1222844	hsa-miR-2682	CLIP-seq
MIRT1222845	hsa-miR-2964a-3p	CLIP-seq
MIRT1222846	hsa-miR-32	CLIP-seq
MIRT1222847	hsa-miR-330-3p	CLIP-seq
MIRT1222848	hsa-miR-3611	CLIP-seq
MIRT1222849	hsa-miR-3613-3p	CLIP-seq
MIRT1222850	hsa-miR-363	CLIP-seq
MIRT1222851	hsa-miR-367	CLIP-seq
MIRT1222852	hsa-miR-3675-3p	CLIP-seq
MIRT1222853	hsa-miR-3679-5p	CLIP-seq
MIRT1222854	hsa-miR-3691-3p	CLIP-seq
MIRT1222855	hsa-miR-3714	CLIP-seq
MIRT1222856	hsa-miR-377	CLIP-seq
MIRT1222857	hsa-miR-4484	CLIP-seq
MIRT1222858	hsa-miR-449c	CLIP-seq
MIRT1222859	hsa-miR-4509	CLIP-seq
MIRT1222860	hsa-miR-4684-5p	CLIP-seq
MIRT1222861	hsa-miR-4694-3p	CLIP-seq
MIRT1222862	hsa-miR-4731-3p	CLIP-seq
MIRT1222863	hsa-miR-4743	CLIP-seq
MIRT1222864	hsa-miR-4801	CLIP-seq
MIRT1222865	hsa-miR-548an	CLIP-seq
MIRT1222866	hsa-miR-548c-3p	CLIP-seq
MIRT1222867	hsa-miR-579	CLIP-seq
MIRT1222868	hsa-miR-92a	CLIP-seq
MIRT1222869	hsa-miR-92b	CLIP-seq
MIRT2064683	hsa-miR-150	CLIP-seq
MIRT2064684	hsa-miR-4456	CLIP-seq
MIRT2064685	hsa-miR-4713-5p	CLIP-seq
MIRT755622	hsa-miR-532-3p	CLIP-seq
MIRT2064686	hsa-miR-942	CLIP-seq
MIRT2064687	hsa-miR-4257	CLIP-seq
MIRT2292839	hsa-miR-514	CLIP-seq
MIRT2292840	hsa-miR-873	CLIP-seq
MIRT2064686	hsa-miR-942	CLIP-seq
MIRT2456159	hsa-miR-3122	CLIP-seq
MIRT1222852	hsa-miR-3675-3p	CLIP-seq
MIRT2456160	hsa-miR-3689a-3p	CLIP-seq
MIRT2456161	hsa-miR-3689c	CLIP-seq
MIRT2456162	hsa-miR-3913-5p	CLIP-seq
MIRT2456163	hsa-miR-4455	CLIP-seq
MIRT1222860	hsa-miR-4684-5p	CLIP-seq
MIRT2456164	hsa-miR-4728-5p	CLIP-seq
MIRT1222863	hsa-miR-4743	CLIP-seq
MIRT1222866	hsa-miR-548c-3p	CLIP-seq
MIRT1222852	hsa-miR-3675-3p	CLIP-seq
MIRT2456163	hsa-miR-4455	CLIP-seq
MIRT1222860	hsa-miR-4684-5p	CLIP-seq
MIRT1222863	hsa-miR-4743	CLIP-seq
MIRT1222866	hsa-miR-548c-3p	CLIP-seq

Show/Hide all(72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	ISS
GO:0001946	Process	Lymphangiogenesis	ISS
GO:0005102	Function	Signaling receptor binding	IDA	18215137
GO:0005372	Function	Water transmembrane transporter activity	ISS
GO:0005515	Function	Protein binding	IPI	17046996, 17616532, 18215137, 18541721, 19268462, 20962267, 25458834, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA	24275092
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	17046996, 18215137, 20962267
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	10393083
GO:0006833	Process	Water transport	ISS
GO:0006865	Process	Amino acid transport	ISS
GO:0007155	Process	Cell adhesion	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IMP	25486435
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008517	Function	Folic acid transmembrane transporter activity	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	17046996, 21376833
GO:0015171	Function	Amino acid transmembrane transporter activity	ISS
GO:0015250	Function	Water channel activity	ISS
GO:0015884	Process	Folic acid transport	ISS
GO:0016020	Component	Membrane	IDA	24275092
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IDA	14978162
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	20962267
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	ISS
GO:0019956	Function	Chemokine binding	IPI	14978162
GO:0030027	Component	Lamellipodium	IBA
GO:0030027	Component	Lamellipodium	ISS
GO:0030054	Component	Cell junction	IDA
GO:0030168	Process	Platelet activation	TAS	18215137
GO:0030175	Component	Filopodium	ISS
GO:0030324	Process	Lung development	ISS
GO:0030335	Process	Positive regulation of cell migration	IMP	21376833
GO:0031258	Component	Lamellipodium membrane	IDA	20962267
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	17046996
GO:0031527	Component	Filopodium membrane	IDA	17046996
GO:0031527	Component	Filopodium membrane	IEA
GO:0031528	Component	Microvillus membrane	IDA	17046996
GO:0031528	Component	Microvillus membrane	IEA
GO:0032587	Component	Ruffle membrane	IDA	17046996
GO:0032587	Component	Ruffle membrane	IEA
GO:0042995	Component	Cell projection	IDA	20962267
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0044319	Process	Wound healing, spreading of cells	IMP	20962267
GO:0045121	Component	Membrane raft	IDA	21376833
GO:0045121	Component	Membrane raft	IEA
GO:0048535	Process	Lymph node development	ISS
GO:0051087	Function	Protein-folding chaperone binding	IPI	23541579
GO:0060838	Process	Lymphatic endothelial cell fate commitment	ISS
GO:0061851	Component	Leading edge of lamellipodium	IDA	17046996
GO:0070161	Component	Anchoring junction	IEA
GO:0070252	Process	Actin-mediated cell contraction	ISS
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IDA	25486435
GO:0097197	Component	Tetraspanin-enriched microdomain	IDA	18541721
GO:1900024	Process	Regulation of substrate adhesion-dependent cell spreading	ISS
GO:1901731	Process	Positive regulation of platelet aggregation	IBA
GO:1901731	Process	Positive regulation of platelet aggregation	IDA	17222411, 20110424
GO:1901731	Process	Positive regulation of platelet aggregation	IMP	17616532, 18541721
GO:1904328	Process	Regulation of myofibroblast contraction	ISS
GO:2000392	Process	Regulation of lamellipodium morphogenesis	IMP	20962267

MIM	HGNC	e!Ensembl
608863	29602	ENSG00000162493

Protein

UniProt ID

Q86YL7

Protein name

Podoplanin (Aggrus) (Glycoprotein 36) (Gp36) (PA2.26 antigen) (T1-alpha) (T1A) [Cleaved into: 29kDa cytosolic podoplanin intracellular domain (PICD)]

Protein function

Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activa

PDB

3WSR , 4YO0 , 5XCV , 7C94 , 7CQC , 7CQD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05808	Podoplanin	28 → 161		Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in

Sequence

MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRY
KSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTT
VEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

Sequence length

162

Interactions

View interactions

	Reactome
			GPVI-mediated activation cascade

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Prostate cancer	Prostate cancer (late onset)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (130)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abnormalities Drug Induced	Associate	21059220
Adenocarcinoma	Associate	20923309, 30257286
Adenocarcinoma of Lung	Associate	36376711
Aicardi Syndrome	Stimulate	31452946
Ameloblastoma	Associate	25820557
Arthritis	Stimulate	28793332
Arthritis Rheumatoid	Associate	21385358, 24932813, 32668112, 36208493
Arthritis Rheumatoid	Stimulate	29476097, 34855235
Astrocytoma	Associate	20665731
Atypical Squamous Cells of the Cervix	Associate	21340215
Blood Coagulation Disorders	Associate	36384269
Blood Platelet Disorders	Associate	24281769, 28073783, 36384269
Blood Platelet Disorders	Stimulate	24987031, 30745334, 32479683
Brain Neoplasms	Associate	26722465, 28073783, 29676036
Breast Neoplasms	Associate	25744065, 28416768, 28938000, 30173230, 37744272
Bursitis	Associate	31013287
Calcifying Epithelial Odontogenic Tumor	Associate	22790409
Cancer Pain	Associate	29719198
Carcinogenesis	Associate	30654768, 35625534
Carcinoma Adenoid Cystic	Associate	21423152, 22580922, 24804195, 31452946
Carcinoma Basal Cell	Stimulate	2366004
Carcinoma Hepatocellular	Associate	28348421, 28871005
Carcinoma Non Small Cell Lung	Associate	19216806
Carcinoma Pancreatic Ductal	Associate	24354864
Carcinoma Renal Cell	Associate	27389969
Carcinoma Squamous Cell	Stimulate	16006773
Carcinoma Squamous Cell	Associate	16415794, 19681903, 21340215, 22790409, 23817087, 25197355, 26700593, 28059107, 28086225, 28656229, 32684738, 33457092, 35264072
Cardiovascular Abnormalities	Associate	24454898
Chondrosarcoma	Associate	18820665
Chordoma	Associate	18820665
Chronic Periodontitis	Associate	19550098
Colorectal Neoplasms	Stimulate	16006773
Colorectal Neoplasms	Associate	19276682, 24015033, 29162097, 37369175
Cysts	Associate	27442396
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	23047035, 35625534
Dupuytren Contracture	Associate	34274346
Dysplastic Nevus Syndrome	Associate	20196862
Edema	Associate	31578434
Esophageal Neoplasms	Associate	32684738
Esophageal Squamous Cell Carcinoma	Associate	21939555, 24103048, 24966946, 25197355, 26095281, 26464673, 26722465, 27035755, 27987372, 28086225
Fibroma Desmoplastic	Stimulate	26163388
Fibrosarcoma	Associate	18158922
Giant Cell Arteritis	Associate	40084998
Giant Cell Tumor of Tendon Sheath	Associate	34855235
Glioblastoma	Associate	20665731, 34713474, 37434432
Glioma	Associate	18492260, 26339454, 36434176, 40554484
Head and Neck Neoplasms	Associate	31967978, 35880270, 39619326
Hemangioendothelioma Epithelioid	Associate	18084256
Hemangioma	Associate	22067331
Hemangiosarcoma	Associate	10027397, 22067331
Hematuria	Associate	35474271
Hypersensitivity Immediate	Associate	22790409
Hypomagnesemia primary	Associate	27313335
Hypoxia	Stimulate	28416768
IgA Vasculitis	Associate	24932813
Infections	Stimulate	15380353, 18057235
Inflammation	Associate	19550098, 31578434
Laryngeal Neoplasms	Stimulate	20196862
Laryngeal Web Familial	Stimulate	24395286
Leukemia	Associate	27035421
Leukemia Myeloid Acute	Associate	27035421
Leukoplakia	Associate	25098985
Leukoplakia Oral	Associate	35625534
Liver Cirrhosis	Associate	21059220
Lung Diseases	Associate	26700593
Lymphangioleiomyomatosis	Associate	27016587
Lymphangioma	Associate	10027397, 17584927
Lymphangioma Cystic	Associate	10027397
Lymphatic Metastasis	Associate	16394285, 20923309, 25119595, 26700593, 28702871, 34939978, 35880270, 37369175, 37744272, 37955536
Lymphatic Metastasis	Inhibit	16528371
Lymphatic Metastasis	Stimulate	16804930, 24966946, 28423532, 32384443
Lymphoma Follicular	Associate	40130551
Lymphoma Non Hodgkin	Associate	40554484
Mesothelioma	Associate	16056246, 16415794, 23041828, 32260559
Mesothelioma Malignant	Associate	32260559
Mouth Diseases	Associate	25098985
Mouth Neoplasms	Associate	16804930, 19773378, 22081310, 23047035, 25119595
Muscular Diseases	Associate	29310601
Mycosis Fungoides	Associate	27545193
Myopathies Structural Congenital	Associate	32384443
Nasopharyngeal Carcinoma	Associate	31321241
Neoplasm Invasiveness	Associate	24103048, 26095281
Neoplasm Metastasis	Stimulate	16394285, 22580922, 26163388, 26722465, 36946268
Neoplasm Metastasis	Inhibit	16528371, 27313335
Neoplasm Metastasis	Associate	19146981, 21340215, 22081310, 23047035, 25197355, 26464673, 27035421, 27389969, 31508790, 32533757, 37369175, 37898647, 37955536
Neoplasms	Associate	10027397, 16804930, 17343736, 18158922, 19146981, 19681903, 20196862, 20661412, 20923309, 21340215, 21385358, 21423152, 22081310, 22763018, 22790409 View all (54 more)
Neoplasms	Inhibit	27313335
Neoplasms	Stimulate	29162097, 34855235, 35625534, 37434432
Neoplasms Cystic Mucinous and Serous	Associate	16056246
Neoplasms Squamous Cell	Associate	37891118
Non Muscle Invasive Bladder Neoplasms	Associate	28423532, 33457092
Obesity	Associate	25857300
Odontogenic Cysts	Associate	22763018
Odontogenic Tumors	Associate	25480364
Odontoma	Associate	21467817
Oropharyngeal Neoplasms	Associate	35256682
Osteosarcoma	Associate	32479683
Ovarian Neoplasms	Associate	25803614
Pancreatic Neoplasms	Associate	28702871
Peritoneal Fibrosis	Stimulate	23300922
Pre Eclampsia	Associate	25528892
Pre Eclampsia	Inhibit	30384554
Pre Eclampsia	Stimulate	31578434
Precancerous Conditions	Associate	19773378, 22081310
Preeclamptic toxemia	Associate	30384554, 31578434
Prostatitis	Associate	24885350
Pulmonary Arterial Hypertension	Associate	38506416
Retinal Dysplasia	Associate	35625534
Salivary Gland Neoplasms	Associate	36946268
Sarcoma	Associate	23774169
Sarcoma Kaposi	Associate	24067801
Seminoma	Associate	16006773
Skull Base Neoplasms	Associate	18820665
Squamous Cell Carcinoma of Head and Neck	Associate	20196862, 23047035, 23817087, 24281769, 25098985, 25119595, 25197355, 26960495, 29719198, 31508790, 33237234, 34939978, 35880270, 36077194, 37993428
Squamous Cell Carcinoma of Head and Neck	Stimulate	22081310
Stomach Neoplasms	Associate	23238856, 31703077, 32384443, 33235820
Supraglottitis	Associate	24395286
Tachycardia Atrioventricular Nodal Reentry	Stimulate	27545193
Tarlov Cysts	Associate	37891118
Tertiary Lymphoid Structures	Associate	15466385, 24814677, 29310601
Testicular Germ Cell Tumor	Associate	34855235
Testicular Neoplasms	Stimulate	16006773
Thrombophilia	Associate	28073783
Thyroid Cancer Papillary	Associate	24797369, 26715280, 30654768, 37955536
Thyroid Neoplasms	Associate	24797369, 30654768, 37955536
Tongue Neoplasms	Associate	16804930
Uterine Cervical Neoplasms	Associate	16528371, 21340215, 35264072
Vascular Neoplasms	Associate	18084256
Venous Thromboembolism	Stimulate	28073783
Venous Thromboembolism	Associate	29676036, 36384269

PDPN (podoplanin)