POLR3C (RNA polymerase III subunit C)

Gene

• Entrez ID: 10623
• Gene name: RNA polymerase III subunit C
• Gene symbol: POLR3C
• Synonyms (NCBI Gene): C82, RPC3, RPC62
• Chromosome: 1
• Chromosome location: 1q21.1

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IDA	21358628
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	TAS	9171375
GO:0005515	Function	Protein binding	IPI	11416169, 20154270, 21358628, 25416956, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005666	Component	RNA polymerase III complex	IBA
GO:0005666	Component	RNA polymerase III complex	IDA	24107381, 33335104, 34675218
GO:0005666	Component	RNA polymerase III complex	IEA
GO:0005666	Component	RNA polymerase III complex	TAS	9171375
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006359	Process	Regulation of transcription by RNA polymerase III	TAS	9171375
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	19609254
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IMP	19609254
GO:0051607	Process	Defense response to virus	IEA

Other IDs

• MIM: 617454
• HGNC: 30076
• e!Ensembl: ENSG00000186141

Protein

• UniProt ID: Q9BUI4
• Protein name: DNA-directed RNA polymerase III subunit RPC3 (RNA polymerase III subunit C3) (DNA-directed RNA polymerase III subunit C) (RNA polymerase III 62 kDa subunit) (RPC62)
• Protein function: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (PubMed:20413673, PubMed:33558764, PubMed:33558766, PubMed:34675218, PubMed:35637192). Specific peripheric compone
• PDB: 2XUB, 2XV4, 5AFQ, 7A6H, 7AE1, 7AE3, 7AEA, 7AST, 7D58, 7D59, 7DN3, 7DU2, 7FJI, 7FJJ, 8ITY, 8IUE, 8IUH, 9FSO, 9FSP, 9FSQ, 9FSR, 9FSS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08221	HTH_9	7 → 68	RNA polymerase III subunit RPC82 helix-turn-helix domain	Domain
  PF05645	RNA_pol_Rpc82	146 → 345	RNA polymerase III subunit RPC82	Family

• Sequence:

  MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQH
  NLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSA
  VVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTL
  VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLD
  RFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVG
  YNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGS
  RCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
  FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAE
  EAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ

• Sequence length: 534

Pathways

KEGG:

RNA polymerase
Cytosolic DNA-sensing pathway

Reactome:

Cytosolic sensors of pathogen-associated DNA
RNA Polymerase III Transcription Initiation From Type 1 Promoter
RNA Polymerase III Transcription Initiation From Type 2 Promoter
RNA Polymerase III Transcription Initiation From Type 3 Promoter

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Decreased total lymphocyte count	Likely benign	rs115748902	RCV002227509
Decreased total neutrophil count	Likely benign	rs115748902	RCV002227509
POLR3C-related disorder	Uncertain significance; Likely benign	rs2526233209, rs2526183502, rs782400288, rs139697925, rs139560249, rs144290770	RCV003416798 RCV003418944 RCV003404417 RCV003914188 RCV003934256 RCV003969597

Associations from Text Mining
Disease Name	Relationship Type	References
Chemical and Drug Induced Liver Injury	Associate	38079352
Neoplasms	Associate	36239794