Gene Gene information from NCBI Gene database.
Entrez ID 10614
Gene name HEXIM P-TEFb complex subunit 1
Gene symbol HEXIM1
Synonyms (NCBI Gene)
CLP1EDG1HIS1MAQ1
Chromosome 17
Chromosome location 17q21.31
Summary Expression of this gene is induced by hexamethylene-bis-acetamide in vascular smooth muscle cells. This gene has no introns. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
285
miRTarBase ID miRNA Experiments Reference
MIRT051053 hsa-miR-17-5p CLASH 23622248
MIRT050765 hsa-miR-17-3p CLASH 23622248
MIRT050623 hsa-miR-20a-5p CLASH 23622248
MIRT046764 hsa-miR-222-3p CLASH 23622248
MIRT042951 hsa-miR-324-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18483487
GO:0002218 Process Activation of innate immune response IDA 28712728
GO:0002376 Process Immune system process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607328 24953 ENSG00000186834
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O94992
Protein name Protein HEXIM1 (Cardiac lineage protein 1) (Estrogen down-regulated gene 1 protein) (Hexamethylene bis-acetamide-inducible protein 1) (Menage a quatre protein 1)
Protein function Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor (PubMed:14580347, PubMed:15201869, PubMed:15713661). Core component of the 7SK RNP complex: in cooperation with 7SK snRNA sequesters P-TEFb in a lar
PDB 2GD7 , 3S9G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15313 HEXIM 164 301 Hexamethylene bis-acetamide-inducible protein Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed with higher expression in placenta. HEXIM1 and HEXIM2 are differentially expressed. Expressed in endocrine tissues. {ECO:0000269|PubMed:12941847, ECO:0000269|PubMed:15713661}.
Sequence
MAEPFLSEYQHQPQTSNCTGAAAVQEELNPERPPGAEERVPEEDSRWQSRAFPQLGGRPG
PEGEGSLESQPPPLQTQACPESSCLREGEKGQNGDDSSAGGDFPPPAEVEPTPEAELLAQ
PCHDSEASKLGAPAAGGEEEWGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDE
KQSLRASRIRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYSKRAAAKSDDTSDDD
FMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSR
M
EDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD
Sequence length 359
Interactions View interactions