Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10588
Gene name Gene Name - the full gene name approved by the HGNC.	Methenyltetrahydrofolate synthetase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MTHFS
Synonyms (NCBI Gene) Gene synonyms aliases	HsT19268, NEDMEHM
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can resu

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023879	hsa-miR-1-3p	Proteomics	18668040
MIRT029878	hsa-miR-26b-5p	Microarray	19088304
MIRT1163447	hsa-miR-1276	CLIP-seq
MIRT1163448	hsa-miR-1305	CLIP-seq
MIRT1163449	hsa-miR-1324	CLIP-seq
MIRT1163450	hsa-miR-141	CLIP-seq
MIRT1163451	hsa-miR-200a	CLIP-seq
MIRT1163452	hsa-miR-23a	CLIP-seq
MIRT1163453	hsa-miR-23b	CLIP-seq
MIRT1163454	hsa-miR-23c	CLIP-seq
MIRT1163455	hsa-miR-3148	CLIP-seq
MIRT1163456	hsa-miR-3163	CLIP-seq
MIRT1163457	hsa-miR-3179	CLIP-seq
MIRT1163458	hsa-miR-3662	CLIP-seq
MIRT1163459	hsa-miR-3920	CLIP-seq
MIRT1163460	hsa-miR-3942-3p	CLIP-seq
MIRT1163461	hsa-miR-4643	CLIP-seq
MIRT1163462	hsa-miR-466	CLIP-seq
MIRT1163463	hsa-miR-4668-5p	CLIP-seq
MIRT1163464	hsa-miR-4687-3p	CLIP-seq
MIRT1163465	hsa-miR-4742-3p	CLIP-seq
MIRT1163466	hsa-miR-4789-3p	CLIP-seq
MIRT1163467	hsa-miR-622	CLIP-seq
MIRT1163468	hsa-miR-630	CLIP-seq
MIRT1163469	hsa-miR-647	CLIP-seq
MIRT1163470	hsa-miR-128	CLIP-seq
MIRT1163471	hsa-miR-1283	CLIP-seq
MIRT1163472	hsa-miR-144	CLIP-seq
MIRT1163473	hsa-miR-27a	CLIP-seq
MIRT1163474	hsa-miR-27b	CLIP-seq
MIRT1163457	hsa-miR-3179	CLIP-seq
MIRT1163475	hsa-miR-3670	CLIP-seq
MIRT1163476	hsa-miR-4633-3p	CLIP-seq
MIRT1163477	hsa-miR-520d-5p	CLIP-seq
MIRT1163478	hsa-miR-520g	CLIP-seq
MIRT1163479	hsa-miR-520h	CLIP-seq
MIRT1163480	hsa-miR-524-5p	CLIP-seq
MIRT1163481	hsa-miR-9	CLIP-seq
MIRT1163452	hsa-miR-23a	CLIP-seq
MIRT1163453	hsa-miR-23b	CLIP-seq
MIRT1163454	hsa-miR-23c	CLIP-seq
MIRT2046991	hsa-miR-3065-5p	CLIP-seq
MIRT1163458	hsa-miR-3662	CLIP-seq
MIRT1163465	hsa-miR-4742-3p	CLIP-seq
MIRT1163467	hsa-miR-622	CLIP-seq
MIRT1163468	hsa-miR-630	CLIP-seq
MIRT2046992	hsa-miR-944	CLIP-seq
MIRT1163460	hsa-miR-3942-3p	CLIP-seq
MIRT2276030	hsa-miR-4257	CLIP-seq
MIRT2276031	hsa-miR-539	CLIP-seq
MIRT2391161	hsa-miR-142-5p	CLIP-seq
MIRT2391162	hsa-miR-340	CLIP-seq
MIRT2276031	hsa-miR-539	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005524	Function	ATP binding	IDA	19738041
GO:0005524	Function	ATP binding	IEA
GO:0005542	Function	Folic acid binding	IDA	7766710, 19738041
GO:0005542	Function	Folic acid binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	7766710
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	7766710
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006536	Process	Glutamate metabolic process	IMP	12764149
GO:0009396	Process	Folic acid-containing compound biosynthetic process	IBA
GO:0015942	Process	Formate metabolic process	NAS	8522195
GO:0016874	Function	Ligase activity	IEA
GO:0030272	Function	5-formyltetrahydrofolate cyclo-ligase activity	IBA
GO:0030272	Function	5-formyltetrahydrofolate cyclo-ligase activity	IDA	7766710, 19738041
GO:0030272	Function	5-formyltetrahydrofolate cyclo-ligase activity	IEA
GO:0030272	Function	5-formyltetrahydrofolate cyclo-ligase activity	IMP	12764149
GO:0030272	Function	5-formyltetrahydrofolate cyclo-ligase activity	NAS	8522195
GO:0030272	Function	5-formyltetrahydrofolate cyclo-ligase activity	TAS
GO:0035999	Process	Tetrahydrofolate interconversion	IBA
GO:0035999	Process	Tetrahydrofolate interconversion	IMP	12764149
GO:0046653	Process	Tetrahydrofolate metabolic process	IDA	7766710, 19738041
GO:0046655	Process	Folic acid metabolic process	TAS
GO:0046657	Process	Folic acid catabolic process	IMP	12764149
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
604197	7437	ENSG00000136371

Protein

UniProt ID

P49914

Protein name

5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) (5,10-methenyl-tetrahydrofolate synthetase) (MTHFS) (Methenyl-THF synthetase)

Protein function

Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversi

PDB

3HXT , 3HY3 , 3HY4 , 3HY6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01812	5-FTHF_cyc-lig	10 → 198	5-formyltetrahydrofolate cyclo-ligase family	Family

Sequence

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQD
EIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVR
EEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQIC
LQVPVNENDMKVDEVLYEDSSTA

Sequence length

203

Interactions

View interactions

	KEGG		Reactome
	One carbon pool by folate Metabolic pathways Folate transport and metabolism		Metabolism of folate and pterines

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Distal hereditary motor neuronopathy	neurodevelopmental disorder with microcephaly, epilepsy, and hypomyelination	N/A	N/A	GenCC

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Congenital central hypoventilation syndrome	Associate	24894164
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	30031689
Genetic Diseases Inborn	Associate	28805617
Heart Defects Congenital	Associate	28264803
Kidney Diseases	Associate	18522750
Lung Neoplasms	Associate	17533396
Lymphoma Non Hodgkin	Associate	17119116
Muscle Spasticity	Associate	30031689
Neoplasms	Associate	17533396
Renal Insufficiency Chronic	Associate	18522750
Small Cell Lung Carcinoma	Associate	17533396

MTHFS (methenyltetrahydrofolate synthetase)