Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10574
Gene name Gene Name - the full gene name approved by the HGNC.	Chaperonin containing TCP1 subunit 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCT7
Synonyms (NCBI Gene) Gene synonyms aliases	CCTETA, CCTH, NIP7-1, TCP1ETA
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777929	C>T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant

Show/Hide all(25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030121	hsa-miR-26b-5p	Microarray	19088304
MIRT049820	hsa-miR-92a-3p	qRT-PCR	23622248
MIRT049820	hsa-miR-92a-3p	CLASH	23622248
MIRT046278	hsa-miR-23b-3p	CLASH	23622248
MIRT041059	hsa-miR-505-3p	CLASH	23622248
MIRT040484	hsa-miR-598-3p	CLASH	23622248
MIRT040174	hsa-miR-615-3p	CLASH	23622248
MIRT036986	hsa-miR-877-3p	CLASH	23622248
MIRT052763	hsa-miR-1260b	CLASH	23622248
MIRT873583	hsa-miR-1264	CLIP-seq
MIRT873584	hsa-miR-3121-3p	CLIP-seq
MIRT873585	hsa-miR-3200-5p	CLIP-seq
MIRT873586	hsa-miR-3653	CLIP-seq
MIRT873587	hsa-miR-600	CLIP-seq
MIRT873584	hsa-miR-3121-3p	CLIP-seq
MIRT873588	hsa-miR-3646	CLIP-seq
MIRT873586	hsa-miR-3653	CLIP-seq
MIRT873589	hsa-miR-3662	CLIP-seq
MIRT873590	hsa-miR-3667-3p	CLIP-seq
MIRT873591	hsa-miR-502-5p	CLIP-seq
MIRT873588	hsa-miR-3646	CLIP-seq
MIRT873586	hsa-miR-3653	CLIP-seq
MIRT873589	hsa-miR-3662	CLIP-seq
MIRT873590	hsa-miR-3667-3p	CLIP-seq
MIRT873591	hsa-miR-502-5p	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14532270, 25416956, 25467444, 28514442, 30021884, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	TAS	9819444
GO:0005829	Component	Cytosol	TAS
GO:0005832	Component	Chaperonin-containing T-complex	IBA	21873635
GO:0005832	Component	Chaperonin-containing T-complex	IDA	23011926, 30955883
GO:0005832	Component	Chaperonin-containing T-complex	TAS	25467444
GO:0005874	Component	Microtubule	IDA	21525035
GO:0006457	Process	Protein folding	IBA	21873635
GO:0006457	Process	Protein folding	IDA	30955883
GO:0006457	Process	Protein folding	TAS
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	25467444
GO:0042802	Function	Identical protein binding	IEA
GO:0044183	Function	Protein folding chaperone	IDA	30955883
GO:0044297	Component	Cell body	IEA
GO:0050821	Process	Protein stabilization	IMP	25467444
GO:0051082	Function	Unfolded protein binding	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:1901998	Process	Toxin transport	IEA
GO:1904851	Process	Positive regulation of establishment of protein localization to telomere	IMP	25467444
GO:1904871	Process	Positive regulation of protein localization to Cajal body	HMP	25467444
GO:1904874	Process	Positive regulation of telomerase RNA localization to Cajal body	HMP	25467444

MIM	HGNC	e!Ensembl
605140	1622	ENSG00000135624

Protein

UniProt ID

Q99832

Protein name

T-complex protein 1 subunit eta (TCP-1-eta) (EC 3.6.1.-) (CCT-eta) (Chaperonin containing T-complex polypeptide 1 subunit 7) (HIV-1 Nef-interacting protein) [Cleaved into: T-complex protein 1 subunit eta, N-terminally processed]

Protein function

Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of actin, tubulin and other proteins upon ATP hydrolysis (PubMed:25467444, PubMed:36493755, PubMed:35449234, PubMed:37193829). The TR

PDB

6NR8 , 6NR9 , 6NRA , 6NRB , 6NRC , 6NRD , 6QB8 , 7LUM , 7LUP , 7NVL , 7NVM , 7NVN , 7NVO , 7TRG , 7TTN , 7TTT , 7TUB , 7WU7 , 7WZ3 , 7X0A , 7X0S , 7X0V , 7X3J , 7X3U , 7X6Q , 7X7Y , 8HKI , 8I1U , 8I9U , 8IB8 , 8SFE , 8SFF , 8SG8 , 8SG9 , 8SGC , 8SGL , 8SGQ , 8SH9 , 8SHA , 8SHD , 8SHE , 8SHF , 8SHG , 8SHL , 8SHN , 8SHO , 8SHP , 8SHQ , 8SHT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00118	Cpn60_TCP1	32 → 524	TCP-1/cpn60 chaperonin family	Family

Sequence

MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISN
DGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQI
IIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVV
DAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALL
NVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVAT
QYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNF
FTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDIN
NEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRG
RPH

Sequence length

543

Interactions

View interactions

	Reactome
			Association of TriC/CCT with target proteins during biosynthesis Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	21364753

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Neurodevelopmental Disorders	neurodevelopmental disorder, complex neurodevelopmental disorder			GenCC

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Hepatocellular	Associate	35073517
Carpal Tunnel Syndrome	Associate	23292503
Cleft Palate	Associate	34382870
Colorectal Neoplasms	Associate	19098285
Dupuytren Contracture	Associate	23292503
Fibrosis	Associate	23292503
Neoplasms	Associate	35073517

CCT7 (chaperonin containing TCP1 subunit 7)