Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10573
Gene name	Mitochondrial ribosomal protein L28
Gene symbol	MRPL28
Synonyms (NCBI Gene)	MAAT1bL28mp15
Chromosome	16
Chromosome location	16p13.3
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019287	hsa-miR-148b-3p	Microarray	17612493
MIRT049955	hsa-miR-30a-5p	CLASH	23622248
MIRT1158941	hsa-miR-1207-5p	CLIP-seq
MIRT1158942	hsa-miR-141	CLIP-seq
MIRT1158943	hsa-miR-147	CLIP-seq
MIRT1158944	hsa-miR-200a	CLIP-seq
MIRT1158945	hsa-miR-28-5p	CLIP-seq
MIRT1158946	hsa-miR-2861	CLIP-seq
MIRT1158947	hsa-miR-3139	CLIP-seq
MIRT1158948	hsa-miR-3153	CLIP-seq
MIRT1158949	hsa-miR-320a	CLIP-seq
MIRT1158950	hsa-miR-320b	CLIP-seq
MIRT1158951	hsa-miR-320c	CLIP-seq
MIRT1158952	hsa-miR-320d	CLIP-seq
MIRT1158953	hsa-miR-320e	CLIP-seq
MIRT1158954	hsa-miR-3622b-5p	CLIP-seq
MIRT1158955	hsa-miR-3911	CLIP-seq
MIRT1158956	hsa-miR-4293	CLIP-seq
MIRT1158957	hsa-miR-4324	CLIP-seq
MIRT1158958	hsa-miR-4429	CLIP-seq
MIRT1158959	hsa-miR-4457	CLIP-seq
MIRT1158960	hsa-miR-4508	CLIP-seq
MIRT1158961	hsa-miR-4512	CLIP-seq
MIRT1158962	hsa-miR-4736	CLIP-seq
MIRT1158963	hsa-miR-4763-3p	CLIP-seq
MIRT1158964	hsa-miR-4802-5p	CLIP-seq
MIRT1158965	hsa-miR-644	CLIP-seq
MIRT1158966	hsa-miR-708	CLIP-seq
MIRT1158967	hsa-miR-765	CLIP-seq
MIRT2045556	hsa-miR-1343	CLIP-seq
MIRT2045557	hsa-miR-18a	CLIP-seq
MIRT2045558	hsa-miR-18b	CLIP-seq
MIRT2045559	hsa-miR-3202	CLIP-seq
MIRT1158953	hsa-miR-320e	CLIP-seq
MIRT2045560	hsa-miR-3652	CLIP-seq
MIRT2045561	hsa-miR-4430	CLIP-seq
MIRT2045562	hsa-miR-4450	CLIP-seq
MIRT2045563	hsa-miR-4480	CLIP-seq
MIRT2045564	hsa-miR-4492	CLIP-seq
MIRT2045565	hsa-miR-4498	CLIP-seq
MIRT2045566	hsa-miR-4533	CLIP-seq
MIRT2045567	hsa-miR-4650-5p	CLIP-seq
MIRT2045568	hsa-miR-4661-3p	CLIP-seq
MIRT2045569	hsa-miR-4667-5p	CLIP-seq
MIRT2045570	hsa-miR-4700-5p	CLIP-seq
MIRT2045571	hsa-miR-4713-3p	CLIP-seq
MIRT2045572	hsa-miR-4722-3p	CLIP-seq
MIRT2045573	hsa-miR-4735-3p	CLIP-seq
MIRT2045574	hsa-miR-762	CLIP-seq
MIRT1158941	hsa-miR-1207-5p	CLIP-seq
MIRT2573334	hsa-miR-1285	CLIP-seq
MIRT2045556	hsa-miR-1343	CLIP-seq
MIRT2045557	hsa-miR-18a	CLIP-seq
MIRT2045558	hsa-miR-18b	CLIP-seq
MIRT1158946	hsa-miR-2861	CLIP-seq
MIRT1158948	hsa-miR-3153	CLIP-seq
MIRT2573335	hsa-miR-3187-5p	CLIP-seq
MIRT2045559	hsa-miR-3202	CLIP-seq
MIRT1158949	hsa-miR-320a	CLIP-seq
MIRT1158950	hsa-miR-320b	CLIP-seq
MIRT1158951	hsa-miR-320c	CLIP-seq
MIRT1158952	hsa-miR-320d	CLIP-seq
MIRT1158953	hsa-miR-320e	CLIP-seq
MIRT2573336	hsa-miR-326	CLIP-seq
MIRT2573337	hsa-miR-330-5p	CLIP-seq
MIRT2045560	hsa-miR-3652	CLIP-seq
MIRT2573338	hsa-miR-378g	CLIP-seq
MIRT1158956	hsa-miR-4293	CLIP-seq
MIRT1158957	hsa-miR-4324	CLIP-seq
MIRT1158958	hsa-miR-4429	CLIP-seq
MIRT2045561	hsa-miR-4430	CLIP-seq
MIRT2045562	hsa-miR-4450	CLIP-seq
MIRT2045563	hsa-miR-4480	CLIP-seq
MIRT2573339	hsa-miR-4486	CLIP-seq
MIRT2045564	hsa-miR-4492	CLIP-seq
MIRT2045565	hsa-miR-4498	CLIP-seq
MIRT1158960	hsa-miR-4508	CLIP-seq
MIRT1158961	hsa-miR-4512	CLIP-seq
MIRT2045566	hsa-miR-4533	CLIP-seq
MIRT2045567	hsa-miR-4650-5p	CLIP-seq
MIRT2045569	hsa-miR-4667-5p	CLIP-seq
MIRT2045570	hsa-miR-4700-5p	CLIP-seq
MIRT2045571	hsa-miR-4713-3p	CLIP-seq
MIRT2045572	hsa-miR-4722-3p	CLIP-seq
MIRT2045573	hsa-miR-4735-3p	CLIP-seq
MIRT1158962	hsa-miR-4736	CLIP-seq
MIRT1158963	hsa-miR-4763-3p	CLIP-seq
MIRT2573340	hsa-miR-612	CLIP-seq
MIRT2045574	hsa-miR-762	CLIP-seq
MIRT1158941	hsa-miR-1207-5p	CLIP-seq
MIRT2573334	hsa-miR-1285	CLIP-seq
MIRT2045556	hsa-miR-1343	CLIP-seq
MIRT1158946	hsa-miR-2861	CLIP-seq
MIRT1158948	hsa-miR-3153	CLIP-seq
MIRT2573335	hsa-miR-3187-5p	CLIP-seq
MIRT1158949	hsa-miR-320a	CLIP-seq
MIRT1158950	hsa-miR-320b	CLIP-seq
MIRT1158951	hsa-miR-320c	CLIP-seq
MIRT1158952	hsa-miR-320d	CLIP-seq
MIRT1158953	hsa-miR-320e	CLIP-seq
MIRT2573336	hsa-miR-326	CLIP-seq
MIRT2573337	hsa-miR-330-5p	CLIP-seq
MIRT2573338	hsa-miR-378g	CLIP-seq
MIRT1158956	hsa-miR-4293	CLIP-seq
MIRT1158957	hsa-miR-4324	CLIP-seq
MIRT1158958	hsa-miR-4429	CLIP-seq
MIRT2045562	hsa-miR-4450	CLIP-seq
MIRT2573339	hsa-miR-4486	CLIP-seq
MIRT1158960	hsa-miR-4508	CLIP-seq
MIRT1158961	hsa-miR-4512	CLIP-seq
MIRT2045567	hsa-miR-4650-5p	CLIP-seq
MIRT2045569	hsa-miR-4667-5p	CLIP-seq
MIRT2045570	hsa-miR-4700-5p	CLIP-seq
MIRT2045571	hsa-miR-4713-3p	CLIP-seq
MIRT1158962	hsa-miR-4736	CLIP-seq
MIRT1158963	hsa-miR-4763-3p	CLIP-seq
MIRT2573340	hsa-miR-612	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	NAS	11543634
GO:0005515	Function	Protein binding	IPI	20601428, 25416956, 31515488, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005761	Component	Mitochondrial ribosome	IDA	20601428
GO:0005761	Component	Mitochondrial ribosome	NAS	11543634
GO:0005762	Component	Mitochondrial large ribosomal subunit	IBA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	25278503, 28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005829	Component	Cytosol	IDA
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	NAS	11543634
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
604853	14484	ENSG00000086504

Q13084

Protein name

Large ribosomal subunit protein bL28m (39S ribosomal protein L28, mitochondrial) (L28mt) (MRP-L28) (Melanoma antigen p15) (Melanoma-associated antigen recognized by T-lymphocytes)

PDB

3J7Y , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6 , 7QH7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00830	Ribosomal_L28	76 → 138	Ribosomal L28 family	Family

Tissue specificity

TISSUE SPECIFICITY: Found in a variety of normal tissues including spleen, testes, thymus, liver, kidney, brain, adrenal, lung and retinal tissue.

Sequence

MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRE
RVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILD
KKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPED
PERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQ
QALSEPAVVQKRASGQ

Sequence length

256

Interactions

View interactions

	KEGG		Reactome
	Ribosome		Mitochondrial translation elongation Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oromandibular-limb hypogenesis spectrum	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Neoplasms	Associate	19753307	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Associate	33542190	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phobia Social	Associate	33542190	★★★★★ ★☆☆☆☆ Found in Text Mining only

MRPL28 (mitochondrial ribosomal protein L28)