Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10568
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 34 member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC34A2
Synonyms (NCBI Gene) Gene synonyms aliases
NAPI-3B, NAPI-IIb, NPTIIb, NaPi2b, PULAM
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different i
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853141 C>T Pathogenic Stop gained, coding sequence variant
rs137853142 G>A,C Pathogenic Missense variant, coding sequence variant
rs796065044 ACCTACCCACTCT>- Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017160 hsa-miR-335-5p Microarray 18185580
MIRT029102 hsa-miR-26b-5p Microarray 19088304
MIRT1360018 hsa-miR-1254 CLIP-seq
MIRT1360019 hsa-miR-1261 CLIP-seq
MIRT1360020 hsa-miR-140-5p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
NFIC Activation 15458926
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0005436 Function Sodium:phosphate symporter activity IBA
GO:0005436 Function Sodium:phosphate symporter activity IDA 10329428, 10610722, 12488042
GO:0005436 Function Sodium:phosphate symporter activity IEA
GO:0005436 Function Sodium:phosphate symporter activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604217 11020 ENSG00000157765
Protein
UniProt ID O95436
Protein name Sodium-dependent phosphate transport protein 2B (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi3b) (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (NaPi-2b) (Solute carrier family 34 member 2)
Protein function Involved in actively transporting phosphate into cells via Na(+) cotransport.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02690 Na_Pi_cotrans 110 249 Na+/Pi-cotransporter Family
PF02690 Na_Pi_cotrans 374 576 Na+/Pi-cotransporter Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium. {ECO:0000269|PubMed:10329428, EC
Sequence
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLI
DEPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSS
AFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHY
LEIITQLIV
ESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVK
IWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI
LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNA
LRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQ
SRCPRVLPKKLQNWNFLPLWMRSL
KPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVK
APETFDNITISREAQGEVPASDSKTECTAL
Sequence length 690
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Parathyroid hormone synthesis, secretion and action
Mineral absorption
  Type II Na+/Pi cotransporters
Defective SLC34A2 causes pulmonary alveolar microlithiasis (PALM)
Surfactant metabolism
Defective SLC34A2 causes pulmonary alveolar microlithiasis (PALM)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Pulmonary Alveolar Microlithiasis pulmonary alveolar microlithiasis rs137853141, rs137853142, rs796065044 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 25017204, 26156586
Adenocarcinoma of Lung Associate 28720066
Breast Neoplasms Associate 34944522
Cancer Pain Associate 34944522
Carcinogenesis Associate 26156586
Carcinoma Hepatocellular Associate 28281971
Carcinoma Non Small Cell Lung Associate 22617245, 25384172, 28720066, 31118036, 38070598
Carcinoma Non Small Cell Lung Inhibit 26156586
Carcinoma Renal Cell Associate 22430804, 23887297
Death Associate 23400546