AKAP3 (A-kinase anchoring protein 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10566
Gene name Gene Name - the full gene name approved by the HGNC.
A-kinase anchoring protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AKAP3
Synonyms (NCBI Gene) Gene synonyms aliases
AKAP 110, AKAP110, CT82, FSP95, HEL159, PRKA3, SOB1, SPGF82
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of A-kinase anchoring proteins (AKAPs), a family of functionally related proteins that target protein kinase A to discrete locations within the cell. The encoded protein is reported to participate in protein-protein interactions
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
miRTarBase ID miRNA Experiments Reference
MIRT775800 hsa-miR-3153 CLIP-seq
MIRT775801 hsa-miR-4519 CLIP-seq
MIRT2169640 hsa-miR-3611 CLIP-seq
MIRT2169641 hsa-miR-3650 CLIP-seq
MIRT2169642 hsa-miR-4693-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(28)
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0001835 Process Blastocyst hatching IEA
GO:0005515 Function Protein binding IPI 11278869, 15257753, 18421703, 25820252, 30683861
GO:0005634 Component Nucleus HDA 21630459
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
604689 373 ENSG00000111254
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID O75969
Protein name A-kinase anchor protein 3 (AKAP-3) (A-kinase anchor protein 110 kDa) (AKAP 110) (Cancer/testis antigen 82) (CT82) (Fibrous sheath protein of 95 kDa) (FSP95) (Fibrousheathin I) (Fibrousheathin-1) (Protein kinase A-anchoring protein 3) (PRKA3) (Sperm oocyte
Protein function Structural component of sperm fibrous sheath (By similarity). Required for the formation of the subcellular structure of the sperm flagellum, sperm motility and male fertility (PubMed:35228300). {ECO:0000250|UniProtKB:O88987, ECO:0000269|PubMed:
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10522 RII_binding_1 122 → 140 RII binding domain Motif
PF05716 AKAP_110 166 → 853 A-kinase anchor protein 110 kDa (AKAP 110) Family
Tissue specificity TISSUE SPECIFICITY: Testis specific; only expressed in spermatids. {ECO:0000269|PubMed:10334916}.
Sequence 
MSEKVDWLQSQNGVCKVDVYSPGDNQAQDWKMDTSTDPVRVLSWLRRDLEKSTAEFQDVR
FKPGESFGGETSNSGDPHKGFSVDYYNTTTKGTPERLHFEMTHKEIPCQGPRAQLGNGSS
VDEVSFYANRLTNLVIAMARKEINEKIDGSENKCVYQSLYMGNEPTPTKSLSKIASELVN
ETVSACSRNAAPDKAPGSGDRVSGSSQSPPNLKYKSTLKIKESTKERQGPDDKPPSKKSF
FYKEVFESRNGDYAREGGRFFPRERKRFRGQERPDDFTASVSEGIMTYANSVVSDMMVSI
MKTLKIQVKDTTIATILLKKVLLKHAKEVVSDLIDSFLRNLHSVTGTLMTDTQFVSAVKR
TVFSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNV
NFAMKSETKLREKMYSEPKSEEETCAKTLGEHIIKEGLTLWHKTQQKECKSLGFQHAAFE
APNTQRKPASDISFEYPEDIGNLSLPPYPPEKPENFMYDSDSWAEDLIVSALLLIQYHLA
QGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRN
LLSETIFKRDQSPEPKVPEQPVKEDRKLCERPLASSPPRLYEDDETPGALSGLTKMAVSQ
IDGHMSGQMVEHLMNSVMKLCVIIAKSCDASLAELGDDKSGDASRLTSAFPDSLYECLPA
KGTGSAEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQAVLQWV
AASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNV
TPLQLLDWLMVNL
Sequence length 853
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Spermatogenic Failure spermatogenic failure 82 N/A N/A GenCC
Show/Hide Text Mining Associations (8)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 26458542, 35322748
Eunuchism Associate 35663320
Fibrous Dysplasia of Bone Associate 11229805
Infertility Associate 35663320
Infertility Male Associate 35256641
Neoplasms Associate 16929165, 26458542
Triple Negative Breast Neoplasms Associate 26458542
Virilism Associate 35663320