OLFM4 (olfactomedin 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10562
Gene name Olfactomedin 4
Gene symbol OLFM4
Synonyms (NCBI Gene)
GC1GW112OLM4OlfDUNQ362bA209J19.1hGC-1hOLfDpDP4
Chromosome 13
Chromosome location 13q14.3
Summary This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth
miRNA miRNA information provided by mirtarbase database.
32
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (32)
miRTarBase ID miRNA Experiments Reference
MIRT018486 hsa-miR-335-5p Microarray 18185580
MIRT053473 hsa-miR-486-5p In situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot 21415212
MIRT439152 hsa-let-7c-5p 3'LIFE 25074381
MIRT439152 hsa-let-7c-5p 3'LIFE 25074381
MIRT1203101 hsa-miR-2682 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
NFKB1 Unknown 18764868
RELA Unknown 18764868
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (29)
GO ID Ontology Definition Evidence Reference
GO:0005198 Function Structural molecule activity IDA 16566923
GO:0005515 Function Protein binding IPI 20534456, 25416956, 31515488, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space HDA 16502470
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
614061 17190 ENSG00000102837
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UX06
Protein name Olfactomedin-4 (OLM4) (Antiapoptotic protein GW112) (G-CSF-stimulated clone 1 protein) (hGC-1) (hOLfD)
Protein function May promote proliferation of pancreatic cancer cells by favoring the transition from the S to G2/M phase. In myeloid leukemic cell lines, inhibits cell growth and induces cell differentiation and apoptosis. May play a role in the inhibition of E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02191 OLF 251 → 505 Olfactomedin-like domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed during myeloid lineage development. Much higher expression in bone marrow neutrophils than in peripheral blood neutrophils (at protein level). Strongly expressed in the prostate, small intestine and colon and moderately expre
Sequence 
MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSL
GSGGSVSQLFSNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKV
REYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGS
SEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPP
PTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLL
EYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAV
TQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNT
WYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQEKVQS
INYNPFDQKLYVYNDGYLLNYDLSVLQKPQ
Sequence length 510
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Neutrophil degranulation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Malignant tumor of esophagus Uncertain significance rs750555521 RCV005939371
Show/Hide Text Mining Associations (80)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 33863396
Adenocarcinoma Associate 31283789, 34222478
Adenoma Stimulate 21986994
Adenoma Associate 36631756, 37667332
Arthritis Juvenile Associate 34480465
Arthritis Rheumatoid Associate 38302188
Asthma Associate 33998076
Atrophy Associate 34928497
Barrett Esophagus Associate 30323168
Bipolar Disorder Stimulate 37147304