OLFM4 (olfactomedin 4)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10562
Gene name Gene Name - the full gene name approved by the HGNC.
Olfactomedin 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OLFM4
Synonyms (NCBI Gene) Gene synonyms aliases
GC1, GW112, OLM4, OlfD, UNQ362, bA209J19.1, hGC-1, hOLfD, pDP4
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(32)
miRTarBase ID miRNA Experiments Reference
MIRT018486 hsa-miR-335-5p Microarray 18185580
MIRT053473 hsa-miR-486-5p In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 21415212
MIRT439152 hsa-let-7c-5p 3'LIFE 25074381
MIRT439152 hsa-let-7c-5p 3'LIFE 25074381
MIRT1203101 hsa-miR-2682 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
NFKB1 Unknown 18764868
RELA Unknown 18764868
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(29)
GO ID Ontology Definition Evidence Reference
GO:0005198 Function Structural molecule activity IDA 16566923
GO:0005515 Function Protein binding IPI 20534456, 25416956, 31515488, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space HDA 16502470
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
614061 17190 ENSG00000102837
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q6UX06
Protein name Olfactomedin-4 (OLM4) (Antiapoptotic protein GW112) (G-CSF-stimulated clone 1 protein) (hGC-1) (hOLfD)
Protein function May promote proliferation of pancreatic cancer cells by favoring the transition from the S to G2/M phase. In myeloid leukemic cell lines, inhibits cell growth and induces cell differentiation and apoptosis. May play a role in the inhibition of E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02191 OLF 251 → 505 Olfactomedin-like domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed during myeloid lineage development. Much higher expression in bone marrow neutrophils than in peripheral blood neutrophils (at protein level). Strongly expressed in the prostate, small intestine and colon and moderately expre
Sequence 
MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSL
GSGGSVSQLFSNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKV
REYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGS
SEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPP
PTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLL
EYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAV
TQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNT
WYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQEKVQS
INYNPFDQKLYVYNDGYLLNYDLSVLQKPQ
Sequence length 510
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Show/Hide Text Mining Associations (80)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 33863396
Adenocarcinoma Associate 31283789, 34222478
Adenoma Stimulate 21986994
Adenoma Associate 36631756, 37667332
Arthritis Juvenile Associate 34480465
Arthritis Rheumatoid Associate 38302188
Asthma Associate 33998076
Atrophy Associate 34928497
Barrett Esophagus Associate 30323168
Bipolar Disorder Stimulate 37147304