Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10561
Gene name Gene Name - the full gene name approved by the HGNC.
Interferon induced protein 44
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IFI44
Synonyms (NCBI Gene) Gene synonyms aliases
MTAP44, TLDC5, p44
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p31.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021249 hsa-miR-146a-5p Microarray 18057241
MIRT023845 hsa-miR-1-3p Microarray 18668037
MIRT029611 hsa-miR-26b-5p Microarray 19088304
MIRT1060234 hsa-miR-4699-3p CLIP-seq
MIRT1060234 hsa-miR-4699-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006955 Process Immune response IBA
GO:0009615 Process Response to virus TAS 7925411
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610468 16938 ENSG00000137965
Protein
UniProt ID Q8TCB0
Protein name Interferon-induced protein 44 (p44) (Microtubule-associated protein 44)
Protein function This protein aggregates to form microtubular structures.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07534 TLD 26 152 TLD Domain
Sequence
MAVTTRLTWLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHI
IGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRN
RKVIMDLKTMENLGLAQNCTISIQDYEVFRCE
DSLDERKIKGVIELRKSLLSALRTYEPY
GSLVQQIRILLLGPIGAGKSSFFNSVRSVFQGHVTHQALVGTNTTGISEKYRTYSIRDGK
DGKYLPFILCDSLGLSEKEGGLCRDDIFYILNGNIRDRYQFNPMESIKLNHHDYIDSPSL
KDRIHCVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDSMDLITKGDLI
EIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILSALRRMLWAADDF
LEDLPFEQIGNLREEIINCAQGKK
Sequence length 444
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anorexia Anorexia nervosa N/A N/A GWAS
Asthma Asthma N/A N/A GWAS
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 36189314
Asthma Associate 19710636
Carcinoma Non Small Cell Lung Associate 19460433
Carotid Body Tumor Associate 30967136
COVID 19 Associate 35958619, 36072597
COVID 19 Stimulate 37569398
Erythema Associate 35967341
Hepatitis C Associate 33785040
Herpes Simplex Associate 34552595
Hypomagnesemia 5 Renal with Ocular Involvement Associate 26005050