IFI44 (interferon induced protein 44)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 10561
Gene name Interferon induced protein 44
Gene symbol IFI44
Synonyms (NCBI Gene)
MTAP44TLDC5p44
Chromosome 1
Chromosome location 1p31.1
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT021249 hsa-miR-146a-5p Microarray 18057241
MIRT023845 hsa-miR-1-3p Microarray 18668037
MIRT029611 hsa-miR-26b-5p Microarray 19088304
MIRT1060234 hsa-miR-4699-3p CLIP-seq
MIRT1060234 hsa-miR-4699-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006955 Process Immune response IBA
GO:0009615 Process Response to virus TAS 7925411
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610468 16938 ENSG00000137965
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TCB0
Protein name Interferon-induced protein 44 (p44) (Microtubule-associated protein 44)
Protein function This protein aggregates to form microtubular structures.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07534 TLD 26 → 152 TLD Domain
Sequence 
MAVTTRLTWLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHI
IGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRN
RKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPY
GSLVQQIRILLLGPIGAGKSSFFNSVRSVFQGHVTHQALVGTNTTGISEKYRTYSIRDGK
DGKYLPFILCDSLGLSEKEGGLCRDDIFYILNGNIRDRYQFNPMESIKLNHHDYIDSPSL
KDRIHCVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDSMDLITKGDLI
EIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILSALRRMLWAADDF
LEDLPFEQIGNLREEIINCAQGKK
Sequence length 444
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Multisystem inflammatory syndrome in children risk factor rs748188421 RCV001779425
Susceptibility to severe COVID-19 Likely risk allele rs2523485070, rs544893099 RCV003120372
RCV003120376
Show/Hide Text Mining Associations (38)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 36189314
Asthma Associate 19710636
Carcinoma Non Small Cell Lung Associate 19460433
Carotid Body Tumor Associate 30967136
COVID 19 Associate 35958619, 36072597
COVID 19 Stimulate 37569398
Erythema Associate 35967341
Hepatitis C Associate 33785040
Herpes Simplex Associate 34552595
Hypomagnesemia 5 Renal with Ocular Involvement Associate 26005050