RPP38 (ribonuclease P/MRP subunit p38)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10557
Gene name Gene Name - the full gene name approved by the HGNC.
Ribonuclease P/MRP subunit p38
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RPP38
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p13
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT001597 hsa-let-7b-5p pSILAC 18668040
MIRT001597 hsa-let-7b-5p Proteomics;Other 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0001650 Component Fibrillar center IBA 21873635
GO:0001650 Component Fibrillar center IDA
GO:0001682 Process TRNA 5'-leader removal IBA 21873635
GO:0001682 Process TRNA 5'-leader removal IDA 30454648
GO:0001682 Process TRNA 5'-leader removal TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606116 30329 ENSG00000152464
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P78345
Protein name Ribonuclease P protein subunit p38 (RNaseP protein p38)
Protein function Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:10444065, PubMed:30454648, PubMed:9037013, PubMed:9630247). Also a component of the MRP ribonuclease complex, which c
PDB 6AHR , 6AHU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01248 Ribosomal_L7Ae 99 → 189 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Domain
Sequence 
MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKI
EDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEV
TRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLAL
AFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLS
KPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK
Sequence length 283
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Ribosome biogenesis in eukaryotes   tRNA processing in the nucleus
Major pathway of rRNA processing in the nucleolus and cytosol
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 22535842
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Inflammation Associate 32330594
Neoplasms Associate 32330594