Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10554
Gene name Gene Name - the full gene name approved by the HGNC.
1-acylglycerol-3-phosphate O-acyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AGPAT1
Synonyms (NCBI Gene) Gene synonyms aliases
1-AGPAT1, G15, LPAAT-alpha, LPAATA, LPLAT1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. Thi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016494 hsa-miR-193b-3p Microarray 20304954
MIRT025835 hsa-miR-7-5p Microarray 19073608
MIRT618407 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT618406 hsa-miR-6817-3p HITS-CLIP 23824327
MIRT618405 hsa-miR-130b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001819 Process Positive regulation of cytokine production IMP 9212163
GO:0001961 Process Positive regulation of cytokine-mediated signaling pathway IC 9212163
GO:0003841 Function 1-acylglycerol-3-phosphate O-acyltransferase activity IBA
GO:0003841 Function 1-acylglycerol-3-phosphate O-acyltransferase activity IDA 9461603, 21873652
GO:0003841 Function 1-acylglycerol-3-phosphate O-acyltransferase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603099 324 ENSG00000204310
Protein
UniProt ID Q99943
Protein name 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (EC 2.3.1.51) (1-acylglycerol-3-phosphate O-acyltransferase 1) (1-AGP acyltransferase 1) (1-AGPAT 1) (Lysophosphatidic acid acyltransferase alpha) (LPAAT-alpha) (Protein G15)
Protein function Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. {ECO:0000269|PubMed:21873652,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01553 Acyltransferase 83 211 Acyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in adipose tissue and at high levels in testis and pancreas. Expressed at lower levels in tissues such as heart, brain, placenta, kidney, lung, spleen, thymus, prostate, ovary, intestine, colon, leukocyte an
Sequence
MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRG
RNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGR
CVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGT
RNHNGSMLPFKRGAFHLAVQAQVPIVPIVMS
SYQDFYCKKERRFTSGQCQVRVLPPVPTE
GLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
Sequence length 283
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phospholipase D signaling pathway
Fat digestion and absorption
  Synthesis of PA
ChREBP activates metabolic gene expression
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Diabetes Type 2 diabetes, Type 2 diabetes mellitus adjusted for BMI or coronary artery disease (pleiotropy), Type 2 diabetes mellitus or coronary artery disease (pleiotropy) N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 21098978
Breast Neoplasms Associate 35441810
Colorectal Neoplasms Associate 25749516, 27992526