Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	10542
Gene name	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
Gene symbol	LAMTOR5
Synonyms (NCBI Gene)	HBXIPXIP
Chromosome	1
Chromosome location	1p13.3
Summary	This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by R

Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001458	hsa-miR-16-5p	pSILAC	18668040
MIRT006082	hsa-miR-520b	ChIP-seqELISAImmunohistochemistryMicroarrayqRT-PCRWestern blot	21343296
MIRT006082	hsa-miR-520b	ChIP-seqELISAImmunohistochemistryMicroarrayqRT-PCRWestern blot	21343296
MIRT006082	hsa-miR-520b	ChIP-seqELISAImmunohistochemistryMicroarrayqRT-PCRWestern blot	21343296
MIRT007340	hsa-miR-501-5p	Luciferase reporter assayqRT-PCRWestern blot	23266610
MIRT024286	hsa-miR-215-5p	Microarray	19074876
MIRT026572	hsa-miR-192-5p	Microarray	19074876
MIRT001458	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT046932	hsa-miR-221-3p	CLASH	23622248
MIRT731993	hsa-miR-548p	Luciferase reporter assayqRT-PCRWestern blot	26583881
MIRT731993	hsa-miR-548p	Luciferase reporter assayqRT-PCRWestern blot	26583881

Show/Hide all (1)

Transcription factor	Regulation	Reference
ERCC2	Repression	22387547

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	22980980
GO:0005515	Function	Protein binding	IPI	12773388, 16169070, 22740693, 23414517, 24169621, 25416956, 25561175, 25567906, 29123114, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	22980980
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	29158492
GO:0005765	Component	Lysosomal membrane	NAS	22980980
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005829	Component	Cytosol	IDA	12773388
GO:0005829	Component	Cytosol	IEA
GO:0008361	Process	Regulation of cell size	IMP	22980980
GO:0009615	Process	Response to virus	TAS	9499022
GO:0010628	Process	Positive regulation of gene expression	IGI	21343296
GO:0019079	Process	Viral genome replication	TAS	9499022
GO:0031902	Component	Late endosome membrane	NAS	20381137
GO:0032008	Process	Positive regulation of TOR signaling	IMP	22980980
GO:0032757	Process	Positive regulation of interleukin-8 production	IGI	21343296
GO:0032991	Component	Protein-containing complex	IDA	12773388
GO:0038202	Process	TORC1 signaling	NAS	22980980
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12773388
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	21343296
GO:0060090	Function	Molecular adaptor activity	IDA	22980980
GO:0061462	Process	Protein localization to lysosome	IMP	22980980
GO:0071230	Process	Cellular response to amino acid stimulus	IBA
GO:0071230	Process	Cellular response to amino acid stimulus	IDA	22980980
GO:0071230	Process	Cellular response to amino acid stimulus	IMP	22980980
GO:0071986	Component	Ragulator complex	IBA
GO:0071986	Component	Ragulator complex	IDA	22980980, 28935770, 29123114, 29158492, 31601708
GO:0071986	Component	Ragulator complex	IEA
GO:0071986	Component	Ragulator complex	IPI	28935770
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	21343296
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	28935770, 29123114, 29158492
GO:1990877	Component	FNIP-folliculin RagC/D GAP	IDA	36103527

MIM	HGNC	e!Ensembl
608521	17955	ENSG00000134248

O43504

Protein name

Ragulator complex protein LAMTOR5 (Hepatitis B virus X-interacting protein) (HBV X-interacting protein) (HBX-interacting protein) (Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5)

Protein function

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed:22980980, PubMed:29158492, PubMed:301

PDB

3MS6 , 3MSH , 5VOK , 5X6U , 5X6V , 5Y38 , 5Y39 , 5Y3A , 5YK3 , 5YK5 , 6B9X , 6EHP , 6EHR , 6NZD , 6U62 , 6ULG , 6WJ2 , 6WJ3 , 7T3A , 7T3B , 7T3C , 7UX2 , 7UXC , 7UXH , 8DHB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16672	LAMTOR5	1 → 88	Ragulator complex protein LAMTOR5	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal and cardiac muscle, followed by pancreas, kidney, liver, brain, placenta and lung (PubMed:9499022). Elevated levels in both cancerous and non-cancerous liver tissue of patients with chronic HBV infection co

Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPT
DIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Sequence length

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway		Macroautophagy mTOR signalling mTORC1-mediated signalling Energy dependent regulation of mTOR by LKB1-AMPK TP53 Regulates Metabolic Genes Regulation of PTEN gene transcription Amino acids regulate mTORC1

LAMTOR5 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 5)