Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10529
Gene name Gene Name - the full gene name approved by the HGNC.
Nebulette
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NEBL
Synonyms (NCBI Gene) Gene synonyms aliases
C10orf113, LASP2, LNEBL, bA165O3.1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p12.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs114875104 G>A Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant, non coding transcript variant, intron variant
rs146275785 G>A,C,T Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, missense variant, non coding transcript variant, intron variant
rs151035799 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant, non coding transcript variant, intron variant
rs193163659 A>G Conflicting-interpretations-of-pathogenicity, likely-benign Genic downstream transcript variant, splice donor variant, downstream transcript variant, intron variant
rs200249470 C>T Conflicting-interpretations-of-pathogenicity, uncertain-significance Intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT046090 hsa-miR-125b-5p CLASH 23622248
MIRT722021 hsa-miR-140-3p HITS-CLIP 19536157
MIRT722020 hsa-miR-4301 HITS-CLIP 19536157
MIRT722019 hsa-miR-3162-3p HITS-CLIP 19536157
MIRT722018 hsa-miR-324-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001725 Component Stress fiber IDA 10470015
GO:0005515 Function Protein binding IPI 11309420, 17987659, 25416956, 26871637, 27733623, 31515488, 32296183, 32814053
GO:0005523 Function Tropomyosin binding IPI 17987659
GO:0008092 Function Cytoskeletal protein binding IDA 10470015
GO:0008092 Function Cytoskeletal protein binding IPI 17987659
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605491 16932 ENSG00000078114
Protein
UniProt ID O76041
Protein name Nebulette (Actin-binding Z-disk protein)
Protein function Binds to actin and plays an important role in the assembly of the Z-disk. May functionally link sarcomeric actin to the desmin intermediate filaments in the heart muscle sarcomeres (PubMed:27733623). ; [Is
PDB 4F14
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00880 Nebulin 35 62 Nebulin repeat Repeat
PF00880 Nebulin 213 240 Nebulin repeat Repeat
PF00880 Nebulin 320 347 Nebulin repeat Repeat
PF00880 Nebulin 356 384 Nebulin repeat Repeat
PF00880 Nebulin 432 456 Nebulin repeat Repeat
PF00880 Nebulin 467 493 Nebulin repeat Repeat
PF00880 Nebulin 504 532 Nebulin repeat Repeat
PF00880 Nebulin 541 568 Nebulin repeat Repeat
PF00880 Nebulin 576 599 Nebulin repeat Repeat
PF00880 Nebulin 607 629 Nebulin repeat Repeat
PF00880 Nebulin 638 663 Nebulin repeat Repeat
PF00880 Nebulin 669 693 Nebulin repeat Repeat
PF00880 Nebulin 732 758 Nebulin repeat Repeat
PF00880 Nebulin 766 793 Nebulin repeat Repeat
PF14604 SH3_9 961 1011 Variant SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in cardiac muscle, but not in skeletal or smooth muscle. Localized to Z-lines in cardiac cells and to dense bodies in nonmuscle cells. Isoform 2 is expressed in non-muscle cells such as in fibroblasts.
Sequence
MRVPVFEDIKDETEEEKIGEEENEEDQVFYKPVIEDLSMELARKCTELISDIRYKEEFKK
SK
DKCTFVTDSPMLNHVKNIGAFISEAKYKGTIKADLSNSLYKRMPATIDSVFAGEVTQL
QSEVAYKQKHDAAKGFSDYAHMKEPPEVKHAMEVNKHQSNISYRKDVQDTHTYSAELDRP
DIKMATQISKIISNAEYKKGQGIMNKEPAVIGRPDFEHAVEASKLSSQIKYKEKFDNEMK
DKKHHYNPLESASFRQNQLAATLASNVKYKKDIQNMHDPVSDLPNLLFLDHVLKASKMLS
GREYKKLFEENKGMYHFDADAVEHLHHKGNAVLQSQVKYKEEYEKNKGKPMLEFVETPSY
QASKEAQKMQSEKVYKEDFEKEIK
GRSSLDLDKTPEFLHVKYITNLLREKEYKKDLENEI
KGKGMELNSEVLDIQRAKRASEMASEKEYKKDLESIIKGKGMQAGTDTLEMQHAKKAAEI
ASEKDYKRDLETE
IKGKGMQVSTDTLDVQRAKKASEMASQKQYKKDLENEIKGKGMQVSM
DIPDILRAKRTSEIYSQRKYKDEAEKMLSNYSTIADTPEIQRIKTTQQNISAVFYKKEVG
AGTAVKDSPEIERVKKNQQNISSVKYKEEIKHATAISDPPELKRVKENQKNISNLQYKEQ
NYK
ATPVSMTPEIERVRRNQEQLSAVKYKGELQRGTAISDPPELKRAKENQKNISNVYYR
GQLGRATTLSVTPEMERVKKNQENISSVKYTQDHKQMKGRPSLILDTPAMRHVKEAQNHI
SMVKYHEDFEKTK
GRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVD
LKVWRTDPGSIFDLDPLEDNIQSRSLHMLSEKASHYRRHWSRSHSSSTFGTGLGDDRSEI
SEIYPSFSCCSEVTRPSDEGAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQHSPNLRTYR
AMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN
Sequence length 1014
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cytoskeleton in muscle cells  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
28416822
Cardiomyopathy Cardiomyopathy, Dilated, Familial dilated cardiomyopathy, Cardiomyopathies rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
27186169
Dilated cardiomyopathy Familial isolated dilated cardiomyopathy rs267607003, rs267607001, rs267607002, rs267607004, rs119463990, rs587777748, rs119463991, rs119463993, rs119464997, rs267606814, rs121908334, rs121909304, rs1369919728, rs121909295, rs121909297
View all (396 more)
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Unknown
Disease term Disease name Evidence References Source
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 28416822 ClinVar
Schizophrenia Schizophrenia GWAS
Eosinophilia Eosinophilia GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 35854639
Arrhythmias Cardiac Associate 32233023
Brugada Syndrome Associate 36303204
Carcinoma Basal Cell Associate 23774526
Carcinoma Hepatocellular Inhibit 32325347
Cardiomyopathies Associate 28815794, 32233023
Colonic Neoplasms Associate 36181111
Colorectal Neoplasms Inhibit 28606091
Colorectal Neoplasms Associate 29257257, 37158531
Conversion Disorder Associate 34371182