Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10528
Gene name Gene Name - the full gene name approved by the HGNC.
NOP56 ribonucleoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NOP56
Synonyms (NCBI Gene) Gene synonyms aliases
NOL5A, SCA36
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SCA36
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p13
Summary Summary of gene provided in NCBI Entrez Gene.
Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. The protein encoded by this gene is simi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030362 hsa-miR-24-3p Microarray 19748357
MIRT049889 hsa-miR-31-5p CLASH 23622248
MIRT1189335 hsa-miR-1257 CLIP-seq
MIRT1189336 hsa-miR-1587 CLIP-seq
MIRT1189337 hsa-miR-2110 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001650 Component Fibrillar center IDA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005515 Function Protein binding IPI 17636026, 32296183
GO:0005654 Component Nucleoplasm TAS
GO:0005730 Component Nucleolus TAS 9372940
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614154 15911 ENSG00000101361
Protein
UniProt ID O00567
Protein name Nucleolar protein 56 (Nucleolar protein 5A)
Protein function Involved in the early to middle stages of 60S ribosomal subunit biogenesis. Required for the biogenesis of box C/D snoRNAs such U3, U8 and U14 snoRNAs (PubMed:12777385, PubMed:15574333). Part of the small subunit (SSU) processome, first precurso
PDB 7MQ8 , 7MQ9 , 7MQA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08156 NOP5NT 5 70 NOP5NT (NUC127) domain Domain
PF01798 Nop 174 407 snoRNA binding domain, fibrillarin Family
Sequence
MVLLHVLFEHAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVA
LENANAVSEG
VVHEDLRLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAE
ILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDK
DINTFSMRVREWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAK
AKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALI
GEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRA
AAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSF
YETGEIPRKNLDV
MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPK
KKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPK
EETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED
Sequence length 594
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ribosome biogenesis in eukaryotes
Spinocerebellar ataxia
  Major pathway of rRNA processing in the nucleolus and cytosol
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Spinocerebellar ataxia Ataxia, Spinocerebellar, Spinocerebellar Ataxia Type 1, Spinocerebellar Ataxia Type 2, Spinocerebellar Ataxia Type 4, Spinocerebellar Ataxia Type 5, Spinocerebellar Ataxia Type 6 (disorder), Spinocerebellar Ataxia Type 7, Spinocerebellar ataxia 36, Spinocerebellar ataxia type 36 rs80356538, rs80356539, rs56144125, rs28937887, rs80356544, rs80356540, rs80356542, rs1941485201, rs121918306, rs151344520, rs151344519, rs151344521, rs151344523, rs151344512, rs193922926
View all (203 more)
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs786205019
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)
21364753
Lung adenocarcinoma Adenocarcinoma of lung (disorder) rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370
View all (5 more)
27602772
Unknown
Disease term Disease name Evidence References Source
Ptosis Blepharoptosis, Ptosis ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Ataxia Associate 22492559
Atherosclerosis Associate 29685964
Carcinoma Hepatocellular Associate 33750838, 34257558
Carcinoma Renal Cell Associate 29099775
Colorectal Neoplasms Associate 20473941
Macular Degeneration Associate 30946360
Mandibulofacial Dysostosis Associate 12777385
Neoplasms Associate 34257558
Neuromuscular Diseases Associate 24269018
Precursor B Cell Lymphoblastic Leukemia Lymphoma Associate 32011831