KAT5 (lysine acetyltransferase 5)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10524
Gene name Gene Name - the full gene name approved by the HGNC.
Lysine acetyltransferase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KAT5
Synonyms (NCBI Gene) Gene synonyms aliases
ESA1, HTATIP, HTATIP1, NEDFASB, PLIP, TIP, TIP60, ZC2HC5, cPLA2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
NEDFASB
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclea
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT039033 hsa-miR-766-3p CLASH 23622248
MIRT1078687 hsa-miR-1203 CLIP-seq
MIRT1078688 hsa-miR-1225-3p CLIP-seq
MIRT1078689 hsa-miR-1233 CLIP-seq
MIRT1078690 hsa-miR-1271 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
ATF2 Repression 18397884
CLOCK Unknown 18458078
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(45)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 17360565
GO:0000729 Process DNA double-strand break processing TAS
GO:0000812 Component Swr1 complex IDA 24463511
GO:0003712 Function Transcription coregulator activity IBA 21873635
GO:0003713 Function Transcription coactivator activity IDA 14966270
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601409 5275 ENSG00000172977
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q92993
Protein name Histone acetyltransferase KAT5 (EC 2.3.1.48) (60 kDa Tat-interactive protein) (Tip60) (Histone acetyltransferase HTATIP) (HIV-1 Tat interactive protein) (Lysine acetyltransferase 5) (Protein 2-hydroxyisobutyryltransferase KAT5) (EC 2.3.1.-) (Protein acety
Protein function Catalytic subunit of the NuA4 histone acetyltransferase complex, a multiprotein complex involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H2A and H4 (PubMed:12776177, PubMed:14966270, PubMe
PDB 2EKO , 2OU2 , 4QQG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11717 Tudor-knot 7 → 65 RNA binding activity-knot of a chromodomain Family
PF17772 zf-MYST 229 → 283 MYST family zinc finger domain Domain
PF01853 MOZ_SAS 288 → 471 MOZ/SAS family Family
Sequence 
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
Sequence length 513
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  ATP-dependent chromatin remodeling
Spinocerebellar ataxia
Human T-cell leukemia virus 1 infection 		  Formation of the beta-catenin:TCF transactivating complex
DNA Damage/Telomere Stress Induced Senescence
HDR through Single Strand Annealing (SSA)
HDR through Homologous Recombination (HRR)
Sensing of DNA Double Strand Breaks
Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Resolution of D-loop Structures through Holliday Junction Intermediates
Nonhomologous End-Joining (NHEJ)
Homologous DNA Pairing and Strand Exchange
Processing of DNA double-strand break ends
Presynaptic phase of homologous DNA pairing and strand exchange
Regulation of TP53 Activity through Phosphorylation
G2/M DNA damage checkpoint
Estrogen-dependent gene expression
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Diabetes Diabetes GWAS
Hypertension Hypertension GWAS
Show/Hide Text Mining Associations (54)
Associations from Text Mining
Disease Name Relationship Type References
Acetyl Coa Carboxylase Deficiency Associate 32822602
Acquired Immunodeficiency Syndrome Associate 10544137
Aortic Aneurysm Abdominal Associate 26767057
Arthritis Rheumatoid Associate 30954385
Ataxia Telangiectasia Associate 18625847
Breast Neoplasms Associate 24947938, 26166158, 26512777, 27581651, 30846725, 33099470
Carcinogenesis Associate 22110127, 31894128, 35705031
Carcinoma Hepatocellular Associate 29174981, 35383533, 36308411
Carcinoma Renal Cell Inhibit 37365518
Carcinoma Squamous Cell Associate 31601649