Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10519
Gene name Gene Name - the full gene name approved by the HGNC.
Calcium and integrin binding 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CIB1
Synonyms (NCBI Gene) Gene synonyms aliases
CIB, CIBP, EV3, KIP1, PRKDCIP, SIP2-28
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q26.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the EF-hand domain-containing calcium-binding superfamily. The encoded protein interacts with many other proteins, including the platelet integrin alpha-IIb-beta-3, DNA-dependent protein kinase, presenilin-2, focal adhesion k
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs143773090 G>A Risk-factor Non coding transcript variant, coding sequence variant, stop gained
rs1323557941 TT>- Risk-factor Coding sequence variant, frameshift variant, non coding transcript variant
rs1351703532 ->AA Risk-factor Frameshift variant, non coding transcript variant, coding sequence variant
rs1567068388 ->C Risk-factor Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029584 hsa-miR-26b-5p Microarray 19088304
MIRT031749 hsa-miR-16-5p Proteomics 18668040
MIRT893412 hsa-miR-1291 CLIP-seq
MIRT893413 hsa-miR-2467-5p CLIP-seq
MIRT893414 hsa-miR-3150b-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IBA
GO:0001525 Process Angiogenesis IEA
GO:0001933 Process Negative regulation of protein phosphorylation ISS
GO:0001934 Process Positive regulation of protein phosphorylation ISS
GO:0001954 Process Positive regulation of cell-matrix adhesion IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602293 16920 ENSG00000185043
Protein
UniProt ID Q99828
Protein name Calcium and integrin-binding protein 1 (CIB) (Calcium- and integrin-binding protein) (CIBP) (Calmyrin) (DNA-PKcs-interacting protein) (Kinase-interacting protein) (KIP) (SNK-interacting protein 2-28) (SIP2-28)
Protein function Calcium-binding protein that plays a role in the regulation of numerous cellular processes, such as cell differentiation, cell division, cell proliferation, cell migration, thrombosis, angiogenesis, cardiac hypertrophy and apoptosis. Involved in
PDB 1DGU , 1DGV , 1XO5 , 1Y1A , 2L4H , 2L4I , 2LM5 , 6OCX , 6OD0
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Expressed in the epidermis, hair follicles and keratinocytes (PubMed:30068544). Detected in platelets and in cell lines of megakaryocytic and erythrocytic lineages. Both isoform 1 and isoform 2 are detected in v
Sequence
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILS
LPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
Sequence length 191
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Epidermodysplasia Verruciformis Epidermodysplasia verruciformis, susceptibility to, 3 rs143773090 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 15685448
Breast Neoplasms Stimulate 20473878
Breast Neoplasms Associate 22964641
Carcinoma Pancreatic Ductal Associate 37187730
Carcinoma Renal Cell Associate 35812454
Cardiovascular Diseases Associate 39426048
Cell Transformation Neoplastic Stimulate 27941888
Chronic Pain Stimulate 33243782
Colorectal Neoplasms Associate 34794407
COVID 19 Associate 37020555