Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10514
Gene name Gene Name - the full gene name approved by the HGNC.	MYB binding protein 1a
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MYBBP1A
Synonyms (NCBI Gene) Gene synonyms aliases	P160, PAP2, Pol5
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a nucleolar transcriptional regulator that was first identified by its ability to bind specifically to the Myb proto-oncogene protein. The encoded protein is thought to play a role in many cellular processes including response to nucleol

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027438	hsa-miR-98-5p	Microarray	19088304
MIRT029101	hsa-miR-26b-5p	Microarray	19088304
MIRT049640	hsa-miR-92a-3p	CLASH	23622248
MIRT047122	hsa-miR-183-5p	CLASH	23622248
MIRT043518	hsa-miR-331-3p	CLASH	23622248
MIRT041453	hsa-miR-193b-3p	CLASH	23622248
MIRT041453	hsa-miR-193b-3p	CLASH	23622248
MIRT038652	hsa-miR-30b-3p	CLASH	23622248
MIRT496504	hsa-miR-3186-5p	PAR-CLIP	22291592
MIRT496504	hsa-miR-3186-5p	PAR-CLIP	22291592
MIRT1167466	hsa-miR-1184	CLIP-seq
MIRT1167467	hsa-miR-1228	CLIP-seq
MIRT1167468	hsa-miR-1291	CLIP-seq
MIRT1167469	hsa-miR-3130-3p	CLIP-seq
MIRT1167470	hsa-miR-3150a-3p	CLIP-seq
MIRT1167471	hsa-miR-3175	CLIP-seq
MIRT1167472	hsa-miR-3620	CLIP-seq
MIRT1167473	hsa-miR-3649	CLIP-seq
MIRT1167474	hsa-miR-4254	CLIP-seq
MIRT1167475	hsa-miR-4292	CLIP-seq
MIRT1167476	hsa-miR-4308	CLIP-seq
MIRT1167477	hsa-miR-4651	CLIP-seq
MIRT1167478	hsa-miR-4655-5p	CLIP-seq
MIRT1167479	hsa-miR-4690-3p	CLIP-seq
MIRT1167480	hsa-miR-4763-5p	CLIP-seq
MIRT1167481	hsa-miR-4787-5p	CLIP-seq
MIRT1167482	hsa-miR-4793-3p	CLIP-seq
MIRT1167483	hsa-miR-491-5p	CLIP-seq
MIRT1167484	hsa-miR-593	CLIP-seq
MIRT1167485	hsa-miR-608	CLIP-seq
MIRT1167486	hsa-miR-885-3p	CLIP-seq
MIRT1167487	hsa-miR-939	CLIP-seq
MIRT1167468	hsa-miR-1291	CLIP-seq
MIRT2048360	hsa-miR-328	CLIP-seq
MIRT1167474	hsa-miR-4254	CLIP-seq
MIRT1167476	hsa-miR-4308	CLIP-seq
MIRT1167469	hsa-miR-3130-3p	CLIP-seq
MIRT2277212	hsa-miR-4714-3p	CLIP-seq
MIRT2277213	hsa-miR-767-5p	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0003677	Function	DNA binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005634	Component	Nucleus	IDA	21471221
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	21471221
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	ISS
GO:0005730	Component	Nucleolus	NAS	23555303
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006338	Process	Chromatin remodeling	NAS	12769854
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	10644447
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0022904	Process	Respiratory electron transport chain	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0042149	Process	Cellular response to glucose starvation	IDA	21471221
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042564	Component	NLS-dependent protein nuclear import complex	IEA
GO:0042564	Component	NLS-dependent protein nuclear import complex	ISS
GO:0043565	Function	Sequence-specific DNA binding	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045943	Process	Positive regulation of transcription by RNA polymerase I	NAS	23555303
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	26044184
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	IDA	16603771
GO:0048511	Process	Rhythmic process	IEA
GO:0070888	Function	E-box binding	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IMP	21471221
GO:0110016	Component	B-WICH complex	IDA	16603771
GO:1903450	Process	Regulation of G1 to G0 transition	IMP	21471221
GO:2000210	Process	Positive regulation of anoikis	IMP	23388179

MIM	HGNC	e!Ensembl
604885	7546	ENSG00000132382

Protein

UniProt ID

Q9BQG0

Protein name

Myb-binding protein 1A

Protein function

May activate or repress transcription via interactions with sequence specific DNA-binding proteins (By similarity). Repression may be mediated at least in part by histone deacetylase activity (HDAC activity) (By similarity). Acts as a corepresso

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04931	DNA_pol_phi	72 → 836	DNA polymerase phi	Family

Sequence

MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEY
LRGRPKGSEMKYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYD
LHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKA
LVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVGSVNLFS
DENVPRLVNVLKMAASSVKKDRKLPAIALDLLRLALKEDKFPRFWKEVVEQGLLKMQFWP
ASYLCFRLLGAALPLLTKEQLHLVMQGDVIRHYGEHVCTAKLPKQFKFAPEMDDYVGTFL
EGCQDDPERQLAVLVAFSSVTNQGLPVTPTFWRVVRFLSPPALQGYVAWLRAMFLQPDLD
SLVDFSTNNQKKAQDSSLHMPERAVFRLRKWIIFRLVSIVDSLHLEMEEALTEQVARFCL
FHSFFVTKKPTSQIPETKHPFSFPLENQAREAVSSAFFSLLQTLSTQFKQAPGQTQGGQP
WTYHLVQFADLLLNHSHNVTTVTPFTAQQRQAWDRMLQTLKELEAHSAEARAAAFQHLLL
LVGIHLLKSPAESCDLLGDIQTCIRKSLGEKPRRSRTKTIDPQEPPWVEVLVEILLALLA
QPSHLMRQVARSVFGHICSHLTPRALQLILDVLNPETSEDENDRVVVTDDSDERRLKGAE
DKSEEGEDNRSSESEEESEGEESEEEERDGDVDQGFREQLMTVLQAGKALGGEDSENEEE
LGDEAMMALDQSLASLFAEQKLRIQARRDEKNKLQKEKALRRDFQIRVLDLVEVLVTKQP
ENALVLELLEPLLSIIRRSLRSSSSKQEQDLLHKTARIFTHHLCRARRYCHDLGERAGAL
HAQVERLVQQAGRQPDSPTALYHFNASLYLLRVLKGNTAEGCVHETQEKQKAGTDPSHMP
TGPQAASCLDLNLVTRVYSTALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHI
TGPVRPRHQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQ
QALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMK
TLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAAT
GGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQ
VNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKA
QVRKAGKP

Sequence length

1328

Interactions

View interactions

	Reactome
			B-WICH complex positively regulates rRNA expression

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
autism	Autism	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	23874428
Breast Neoplasms	Associate	19095746, 22002538
Drug Hypersensitivity	Associate	28574850
Esophageal Neoplasms	Associate	39465737
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19095746
Neoplasm Metastasis	Associate	23874428, 26066330
Neoplasms	Associate	26066330
Pancreatitis	Associate	28574850
Prostatic Neoplasms	Associate	23559371, 38305916
Thrombosis	Associate	28574850

MYBBP1A (MYB binding protein 1a)