Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1051
Gene name Gene Name - the full gene name approved by the HGNC.	CCAAT enhancer binding protein beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CEBPB
Synonyms (NCBI Gene) Gene synonyms aliases	C/EBP-beta, IL6DBP, NF-IL6, TCF5
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.13
Summary Summary of gene provided in NCBI Entrez Gene.	This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of t

Show/Hide all(258)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay	18367535
MIRT001560	hsa-miR-155-5p	Review	20029422
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	20427544
MIRT001560	hsa-miR-155-5p	pSILAC	18668040
MIRT001560	hsa-miR-155-5p	Microarray, qRT-PCR, Western blot	19193853
MIRT005723	hsa-miR-34a-5p	Luciferase reporter assay	20598588
MIRT006090	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT006090	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay	19596814
MIRT001560	hsa-miR-155-5p	ELISA, Immunoblot, Immunocytochemistry, Immunofluorescence, Luciferase reporter assay, qRT-PCR	19887047
MIRT006090	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay	19596814
MIRT001560	hsa-miR-155-5p	ELISA, Immunoblot, Immunocytochemistry, Immunofluorescence, Luciferase reporter assay, qRT-PCR	19887047
MIRT016122	hsa-miR-421	Sequencing	20371350
MIRT001560	hsa-miR-155-5p	Proteomics	18668040
MIRT005723	hsa-miR-34a-5p	Reporter assay	20598588
MIRT038165	hsa-miR-423-5p	CLASH	23622248
MIRT001560	hsa-miR-155-5p	Western blot	23749759
MIRT001560	hsa-miR-155-5p	Chip, ELISA, Luciferase reporter assay, QRTPCR, Western blot	23612310
MIRT437806	hsa-let-7c-5p	Luciferase reporter assay	23667114
MIRT296299	hsa-miR-374a-5p	Luciferase reporter assay	23468252
MIRT154313	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	25094047
MIRT154313	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	25094047
MIRT202310	hsa-miR-548n	PAR-CLIP	20371350
MIRT202317	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT202311	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT202308	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT235776	hsa-miR-4255	PAR-CLIP	20371350
MIRT202313	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT564030	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT564029	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT564028	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT564027	hsa-miR-371a-5p	PAR-CLIP	20371350
MIRT564026	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT154323	hsa-miR-2116-5p	PAR-CLIP	20371350
MIRT564025	hsa-miR-22-5p	PAR-CLIP	20371350
MIRT564024	hsa-miR-4477a	PAR-CLIP	20371350
MIRT564023	hsa-miR-513c-5p	PAR-CLIP	20371350
MIRT564022	hsa-miR-514b-5p	PAR-CLIP	20371350
MIRT407003	hsa-miR-4677-5p	PAR-CLIP	20371350
MIRT001560	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT001560	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT154313	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	25784653
MIRT038165	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT038165	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT038165	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT736781	hsa-miR-155-3p	qRT-PCR	32366887
MIRT736781	hsa-miR-155-3p	Western blotting, qRT-PCR	32481686
MIRT202310	hsa-miR-548n	PAR-CLIP	20371350
MIRT202317	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT202311	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT202308	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT235776	hsa-miR-4255	PAR-CLIP	20371350
MIRT202313	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT564030	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT564029	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT564028	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT564027	hsa-miR-371a-5p	PAR-CLIP	20371350
MIRT564026	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT154323	hsa-miR-2116-5p	PAR-CLIP	20371350
MIRT564025	hsa-miR-22-5p	PAR-CLIP	20371350
MIRT564024	hsa-miR-4477a	PAR-CLIP	20371350
MIRT564023	hsa-miR-513c-5p	PAR-CLIP	20371350
MIRT564022	hsa-miR-514b-5p	PAR-CLIP	20371350
MIRT407003	hsa-miR-4677-5p	PAR-CLIP	20371350
MIRT001560	hsa-miR-155-5p	Western blotting, qRT-PCR	37505742
MIRT883257	hsa-miR-1207-5p	CLIP-seq
MIRT883258	hsa-miR-1225-3p	CLIP-seq
MIRT883259	hsa-miR-1273e	CLIP-seq
MIRT883260	hsa-miR-147b	CLIP-seq
MIRT883261	hsa-miR-1537	CLIP-seq
MIRT883262	hsa-miR-155	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883264	hsa-miR-1909	CLIP-seq
MIRT883265	hsa-miR-191	CLIP-seq
MIRT883266	hsa-miR-1910	CLIP-seq
MIRT883267	hsa-miR-2116	CLIP-seq
MIRT883268	hsa-miR-2277-5p	CLIP-seq
MIRT883269	hsa-miR-3121-3p	CLIP-seq
MIRT883270	hsa-miR-3157-5p	CLIP-seq
MIRT883271	hsa-miR-3177-5p	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883273	hsa-miR-3189-5p	CLIP-seq
MIRT883274	hsa-miR-3191	CLIP-seq
MIRT883275	hsa-miR-329	CLIP-seq
MIRT883276	hsa-miR-3591-3p	CLIP-seq
MIRT883277	hsa-miR-362-3p	CLIP-seq
MIRT883278	hsa-miR-369-3p	CLIP-seq
MIRT883279	hsa-miR-374a	CLIP-seq
MIRT883280	hsa-miR-374b	CLIP-seq
MIRT883281	hsa-miR-374c	CLIP-seq
MIRT883282	hsa-miR-376a	CLIP-seq
MIRT883283	hsa-miR-376b	CLIP-seq
MIRT883284	hsa-miR-376c	CLIP-seq
MIRT883285	hsa-miR-3941	CLIP-seq
MIRT883286	hsa-miR-4282	CLIP-seq
MIRT883287	hsa-miR-4323	CLIP-seq
MIRT883288	hsa-miR-4480	CLIP-seq
MIRT883289	hsa-miR-4520a-3p	CLIP-seq
MIRT883290	hsa-miR-4520b-3p	CLIP-seq
MIRT883291	hsa-miR-4529-3p	CLIP-seq
MIRT883292	hsa-miR-455-3p	CLIP-seq
MIRT883293	hsa-miR-4643	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883296	hsa-miR-466	CLIP-seq
MIRT883297	hsa-miR-4691-3p	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT883299	hsa-miR-4711-5p	CLIP-seq
MIRT883300	hsa-miR-4716-3p	CLIP-seq
MIRT883301	hsa-miR-4716-5p	CLIP-seq
MIRT883302	hsa-miR-4763-3p	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883304	hsa-miR-4789-3p	CLIP-seq
MIRT883305	hsa-miR-603	CLIP-seq
MIRT883306	hsa-miR-655	CLIP-seq
MIRT883276	hsa-miR-3591-3p	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883258	hsa-miR-1225-3p	CLIP-seq
MIRT883260	hsa-miR-147b	CLIP-seq
MIRT883262	hsa-miR-155	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883273	hsa-miR-3189-5p	CLIP-seq
MIRT883276	hsa-miR-3591-3p	CLIP-seq
MIRT883284	hsa-miR-376c	CLIP-seq
MIRT883287	hsa-miR-4323	CLIP-seq
MIRT883289	hsa-miR-4520a-3p	CLIP-seq
MIRT883290	hsa-miR-4520b-3p	CLIP-seq
MIRT883291	hsa-miR-4529-3p	CLIP-seq
MIRT883293	hsa-miR-4643	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883296	hsa-miR-466	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883304	hsa-miR-4789-3p	CLIP-seq
MIRT1961895	hsa-miR-561	CLIP-seq
MIRT883258	hsa-miR-1225-3p	CLIP-seq
MIRT2198457	hsa-miR-1266	CLIP-seq
MIRT883260	hsa-miR-147b	CLIP-seq
MIRT2198458	hsa-miR-1538	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883266	hsa-miR-1910	CLIP-seq
MIRT883267	hsa-miR-2116	CLIP-seq
MIRT883268	hsa-miR-2277-5p	CLIP-seq
MIRT2198459	hsa-miR-3120-3p	CLIP-seq
MIRT2198460	hsa-miR-3127-5p	CLIP-seq
MIRT883270	hsa-miR-3157-5p	CLIP-seq
MIRT883271	hsa-miR-3177-5p	CLIP-seq
MIRT2198461	hsa-miR-3178	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883273	hsa-miR-3189-5p	CLIP-seq
MIRT883275	hsa-miR-329	CLIP-seq
MIRT883276	hsa-miR-3591-3p	CLIP-seq
MIRT883277	hsa-miR-362-3p	CLIP-seq
MIRT2198462	hsa-miR-3660	CLIP-seq
MIRT883284	hsa-miR-376c	CLIP-seq
MIRT2198463	hsa-miR-3914	CLIP-seq
MIRT2198464	hsa-miR-3918	CLIP-seq
MIRT2198465	hsa-miR-3940-5p	CLIP-seq
MIRT883285	hsa-miR-3941	CLIP-seq
MIRT883287	hsa-miR-4323	CLIP-seq
MIRT2198466	hsa-miR-4503	CLIP-seq
MIRT2198467	hsa-miR-4507	CLIP-seq
MIRT2198468	hsa-miR-4518	CLIP-seq
MIRT883289	hsa-miR-4520a-3p	CLIP-seq
MIRT883290	hsa-miR-4520b-3p	CLIP-seq
MIRT2198469	hsa-miR-4526	CLIP-seq
MIRT883291	hsa-miR-4529-3p	CLIP-seq
MIRT883292	hsa-miR-455-3p	CLIP-seq
MIRT883293	hsa-miR-4643	CLIP-seq
MIRT2198470	hsa-miR-4645-3p	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883296	hsa-miR-466	CLIP-seq
MIRT883297	hsa-miR-4691-3p	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT2198471	hsa-miR-4709-5p	CLIP-seq
MIRT883301	hsa-miR-4716-5p	CLIP-seq
MIRT2198472	hsa-miR-4745-3p	CLIP-seq
MIRT2198473	hsa-miR-4767	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883304	hsa-miR-4789-3p	CLIP-seq
MIRT2198474	hsa-miR-510	CLIP-seq
MIRT2198475	hsa-miR-512-5p	CLIP-seq
MIRT2198476	hsa-miR-548t	CLIP-seq
MIRT1961895	hsa-miR-561	CLIP-seq
MIRT883305	hsa-miR-603	CLIP-seq
MIRT2198477	hsa-miR-935	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883266	hsa-miR-1910	CLIP-seq
MIRT883271	hsa-miR-3177-5p	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883275	hsa-miR-329	CLIP-seq
MIRT883277	hsa-miR-362-3p	CLIP-seq
MIRT2198462	hsa-miR-3660	CLIP-seq
MIRT883285	hsa-miR-3941	CLIP-seq
MIRT2198469	hsa-miR-4526	CLIP-seq
MIRT883292	hsa-miR-455-3p	CLIP-seq
MIRT2198470	hsa-miR-4645-3p	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT883305	hsa-miR-603	CLIP-seq
MIRT2198477	hsa-miR-935	CLIP-seq
MIRT883269	hsa-miR-3121-3p	CLIP-seq
MIRT883282	hsa-miR-376a	CLIP-seq
MIRT883283	hsa-miR-376b	CLIP-seq
MIRT883261	hsa-miR-1537	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883270	hsa-miR-3157-5p	CLIP-seq
MIRT883271	hsa-miR-3177-5p	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883275	hsa-miR-329	CLIP-seq
MIRT883277	hsa-miR-362-3p	CLIP-seq
MIRT883284	hsa-miR-376c	CLIP-seq
MIRT883285	hsa-miR-3941	CLIP-seq
MIRT883293	hsa-miR-4643	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883296	hsa-miR-466	CLIP-seq
MIRT883297	hsa-miR-4691-3p	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT883299	hsa-miR-4711-5p	CLIP-seq
MIRT883301	hsa-miR-4716-5p	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883304	hsa-miR-4789-3p	CLIP-seq
MIRT883305	hsa-miR-603	CLIP-seq
MIRT883266	hsa-miR-1910	CLIP-seq
MIRT2198465	hsa-miR-3940-5p	CLIP-seq
MIRT2198467	hsa-miR-4507	CLIP-seq
MIRT883292	hsa-miR-455-3p	CLIP-seq
MIRT2198470	hsa-miR-4645-3p	CLIP-seq
MIRT2198477	hsa-miR-935	CLIP-seq
MIRT2198459	hsa-miR-3120-3p	CLIP-seq
MIRT883269	hsa-miR-3121-3p	CLIP-seq
MIRT883278	hsa-miR-369-3p	CLIP-seq
MIRT883279	hsa-miR-374a	CLIP-seq
MIRT883280	hsa-miR-374b	CLIP-seq
MIRT883281	hsa-miR-374c	CLIP-seq
MIRT883282	hsa-miR-376a	CLIP-seq
MIRT883283	hsa-miR-376b	CLIP-seq
MIRT2198463	hsa-miR-3914	CLIP-seq
MIRT2198471	hsa-miR-4709-5p	CLIP-seq
MIRT883306	hsa-miR-655	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ATF4	Activation	16026328
ESR1	Unknown	19652226

Show/Hide all(71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS	15308669
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	7959007
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	15308669
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001541	Process	Ovarian follicle development	ISS
GO:0001892	Process	Embryonic placenta development	IEA
GO:0003677	Function	DNA binding	TAS	10821850
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	10821850
GO:0005515	Function	Protein binding	IPI	7651415, 12692227, 16227626, 17724128, 18820298, 20102225, 20111005, 20829347, 24043631, 31527615
GO:0005634	Component	Nucleus	IDA	20829347
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	20829347
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006953	Process	Acute-phase response	TAS	2112087
GO:0006954	Process	Inflammatory response	TAS	2112087
GO:0006955	Process	Immune response	TAS	2112087
GO:0007613	Process	Memory	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0032675	Process	Regulation of interleukin-6 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	20829347
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0035259	Function	Glucocorticoid receptor binding	IEA
GO:0036488	Component	CHOP-C/EBP complex	NAS	15775988
GO:0042130	Process	Negative regulation of T cell proliferation	ISS
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	IEA
GO:0045595	Process	Regulation of cell differentiation	IBA	21873635
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	27812542
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	27812542
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7959007
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0060644	Process	Mammary gland epithelial cell differentiation	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	14685163
GO:0070169	Process	Positive regulation of biomineral tissue development	IDA	27812542
GO:0070169	Process	Positive regulation of biomineral tissue development	IMP	27812542
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071407	Process	Cellular response to organic cyclic compound	IEA
GO:0072574	Process	Hepatocyte proliferation	ISS
GO:0097421	Process	Liver regeneration	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	15762841
GO:1901329	Process	Regulation of odontoblast differentiation	ISS	15308669
GO:1990440	Process	Positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	15775988
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000120	Process	Positive regulation of sodium-dependent phosphate transport	IDA	27812542
GO:2000120	Process	Positive regulation of sodium-dependent phosphate transport	IMP	27812542
GO:2001198	Process	Regulation of dendritic cell differentiation	IEA

MIM	HGNC	e!Ensembl
189965	1834	ENSG00000172216

Protein

UniProt ID

P17676

Protein name

CCAAT/enhancer-binding protein beta (C/EBP beta) (Liver activator protein) (LAP) (Liver-enriched inhibitory protein) (LIP) (Nuclear factor NF-IL6) (Transcription factor 5) (TCF-5)

Protein function

Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:12048245, PubMed:1741402, PubMed:18647749, PubMed:9374525). Also plays a significant role in adipogenesis, as well as in the

PDB

1GTW , 1GU4 , 1GU5 , 1H88 , 1H89 , 1H8A , 1HJB , 1IO4 , 2E42 , 2E43 , 6MG1 , 6MG2 , 6MG3 , 7L4V , 7UPZ , 8K8D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07716	bZIP_2	270 → 323	Basic region leucine zipper	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed at low levels in the lung, kidney and spleen.

Sequence

MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

Sequence length

345

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis IL-17 signaling pathway TNF signaling pathway Tuberculosis Transcriptional misregulation in cancer		Senescence-Associated Secretory Phenotype (SASP) Transcriptional regulation of white adipocyte differentiation Transcriptional Regulation by VENTX Response of EIF2AK4 (GCN2) to amino acid deficiency Response of EIF2AK1 (HRI) to heme deficiency

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578 View all (1 more)	17177178

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Diabetes	Diabetes		GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA

Show/Hide Text Mining Associations (161)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenomyosis	Associate	31576674
AIDS Associated Nephropathy	Stimulate	32276639
Alzheimer Disease	Associate	21281310, 22818222
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	22403660
Arthritis	Associate	19248099, 21917825
Arthritis Psoriatic	Associate	21917825
Arthritis Rheumatoid	Stimulate	10902764, 25811130
Arthritis Rheumatoid	Associate	30231487, 30894209
Astrocytoma	Associate	22818222
Atrophy	Stimulate	34854237
Behcet Syndrome	Associate	28166214, 29907633
Bile Duct Neoplasms	Stimulate	36996081
Body Weight	Associate	26865646
Brain Neoplasms	Stimulate	32526700
Breast Neoplasms	Associate	19221050, 19652226, 21057224, 21689417, 23405208, 24789216, 31019204, 33660927, 35674458
Bronchiolitis Obliterans Syndrome	Associate	18354170
Burkitt Lymphoma	Associate	21447826
Carcinogenesis	Associate	23741337, 33660927, 36694148
Carcinoma Embryonal	Associate	8455626
Carcinoma Hepatocellular	Associate	16026328, 28198412, 32704163
Carcinoma Non Small Cell Lung	Associate	33219226
Carcinoma Pancreatic Ductal	Associate	36675048
Carcinoma Renal Cell	Associate	23342250, 32593213
Carcinoma Squamous Cell	Associate	25402211
Cardiomegaly	Associate	37098980
Cardiomyopathy Hypertrophic	Associate	30338905
Cardiovascular Diseases	Associate	20460359
Cartilage Diseases	Associate	19248099
Cholangiocarcinoma	Associate	35550144, 35672673
Choledochal Cyst	Associate	36996081
Colitis Ulcerative	Associate	35484353, 36272033
Colorectal Neoplasms	Associate	20110283, 27433286, 30658502, 33892791, 36129029, 38019240, 9374525
Coronary Artery Disease	Associate	25835000, 34897030
Coronavirus Infections	Associate	33968364
COVID 19	Stimulate	37936693
COVID 19	Associate	40253079
Crohn Disease	Associate	28166214
Cystic Fibrosis	Associate	36206743
Dendritic Cell Sarcoma Follicular	Stimulate	18272816
Depressive Disorder Major	Associate	36281744
Diabetes Mellitus Type 2	Associate	20460359
Diabetic Nephropathies	Associate	36978091
Down Syndrome	Associate	16100769
Dyskeratosis Congenita	Associate	37717172
Ectrodactyly	Associate	21281310
Encephalitis	Stimulate	21281310
Endometrial Hyperplasia	Stimulate	40461968
Endometrial Neoplasms	Associate	12713669
Endometrial Neoplasms	Stimulate	40461968
Endometriosis	Associate	18583320
Eosinophilic Esophagitis	Associate	37972740
Epilepsy Absence	Stimulate	32276639
Familial Primary Pulmonary Hypertension	Associate	36899621
Fetal Growth Retardation	Associate	35090410
Glioblastoma	Associate	22440258, 27572958, 32477324, 32526700, 35836243
Glioma	Associate	27572958, 27716259, 32477324
Glomerulonephritis Membranous	Associate	28760550
Glomerulosclerosis Focal Segmental	Associate	30389788
Glycosuria Renal	Associate	36978091
Graves Ophthalmopathy	Associate	31415657, 33488522
Heart Arrest	Stimulate	25772238
Heart Failure	Associate	12601168, 32460775
Hematologic Neoplasms	Associate	36528879, 39769352
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	37181035
HIV Infections	Stimulate	21281310
Hyperalgesia	Associate	35451875
Hypertension	Associate	27400471
Hypertrophy	Associate	37098980
Hypoxia	Stimulate	30587688
Hypoxia	Associate	30894209
Hypoxia Brain	Associate	22440258
Hypoxia Brain	Stimulate	30587688
Idiopathic Pulmonary Fibrosis	Associate	34831059
IgA Vasculitis	Associate	10902764
Infections	Associate	21281310
Inflammation	Associate	10887174, 12707271, 17043106, 18555778, 19723873, 19887047, 21935477, 22818222, 25835000, 26511475, 26682910, 28151579, 28206970, 32276639, 34854237 View all (6 more)
Inflammation	Inhibit	19434061
Inflammation	Stimulate	32593213
Inflammatory Bowel Diseases	Associate	35212366
Insulin Resistance	Associate	17986714
Intracranial Aneurysm	Associate	32084215
Ischemia	Associate	21048961
Leprosy	Associate	28166214
Leukemia	Associate	25127121, 36913305
Leukemia	Stimulate	37554265
Leukemia Biphenotypic Acute	Associate	26868379
Leukemia Lymphocytic Chronic B Cell	Associate	27590344
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	16418324, 27716259
Leukemia Myeloid	Associate	1391942, 25448741
Leukemia Myeloid Acute	Associate	16046262, 16418324, 24264602, 25127121, 26868909, 29966306, 33958723, 34207065, 36913305
Leukemia Myeloid Acute	Inhibit	17854664
Leukemia Promyelocytic Acute	Associate	14592978, 23711709, 33901013
Leukoencephalopathy Progressive Multifocal	Associate	19747512
Light Fixation Seizure Syndrome	Stimulate	16563127
Liposarcoma	Associate	26193637
Lung Diseases	Associate	30530593
Lung Neoplasms	Associate	19723873, 21150337, 24488911
Lymphoma	Associate	16709933
Lymphoma Large B Cell Diffuse	Stimulate	39614427
Lymphoma Large Cell Anaplastic	Associate	16709933, 17077326, 23741337, 25688981, 28581487
Lymphoma Mantle Cell	Associate	18416826
Malignant mesenchymal tumor	Associate	37192160
Melanoma Cutaneous Malignant	Associate	32467529, 36353635
Metabolic Diseases	Associate	20460359
Metabolic Syndrome	Associate	33540559
Mouth Neoplasms	Associate	25229239
Moyamoya Disease	Associate	32617116
Multiple Myeloma	Associate	21389327
Nasopharyngeal Carcinoma	Associate	16414987, 30945396
Necrosis	Associate	22440258
Neoplasms	Associate	10098766, 16709933, 18462018, 19887047, 19958352, 21283634, 22081596, 22495929, 24454781, 25402211, 25772238, 26868909, 27433286, 27716259, 29712898 View all (11 more)
Neoplasms	Stimulate	34854237
Neoplasms Adipose Tissue	Associate	22309242
Neoplasms Glandular and Epithelial	Associate	10098766
Neuralgia	Associate	36855217
Neurodegenerative Diseases	Associate	36674978
Neuroinflammatory Diseases	Associate	21281310, 22818222, 36674978
Neurologic Manifestations	Associate	15063753
Non alcoholic Fatty Liver Disease	Associate	28206970
Obesity	Associate	20460359, 22309242
Obesity Abdominal	Associate	20460359
Obesity Maternal	Inhibit	29763375
Oligodendroglioma	Associate	10590092
Osteoarthritis	Associate	38554527
Osteosarcoma	Associate	28942243, 31364785
Ovarian Neoplasms	Associate	10098766, 29712898, 37303939
Ovarian Neoplasms	Stimulate	12713669
Pain Postoperative	Associate	35451875
Parkinson Disease	Associate	21281310, 22818222, 36674978
Periodontitis	Associate	40127057
Postthrombotic Syndrome	Associate	27400471
Prostatic Neoplasms	Associate	22081596, 25772238
Protein Deficiency	Associate	26762974
Pulmonary Disease Chronic Obstructive	Stimulate	26511475
Recurrent respiratory papillomatosis	Associate	9853426
Root Resorption	Associate	30587688
Rupture	Associate	32084215
Sarcoma Ewing	Associate	28148901
Sarcoma Kaposi	Associate	9199351
Sarcopenia	Associate	15687482
Sepsis	Associate	12707271
Shock Cardiogenic	Associate	31856860
Shock Septic	Associate	31856860
Shwachman Diamond Syndrome	Associate	26762974
Smoke Inhalation Injury	Associate	31019204
Squamous Cell Carcinoma of Head and Neck	Associate	25229239, 35365168
Status Asthmaticus	Associate	19734226
Stomach Neoplasms	Associate	16414987, 16474375, 36514982, 37192160
Stress Disorders Post Traumatic	Associate	36281744
Synovitis	Associate	10902764
Tertiary Lymphoid Structures	Inhibit	36675048
Thrombocythemia Essential	Associate	33599741
Thyroid Cancer Papillary	Associate	18682709
Thyroid Neoplasms	Associate	18682709
Triple Negative Breast Neoplasms	Associate	30335837, 33660927, 40022434
Tuberculosis	Stimulate	25329476
Tuberculosis Pulmonary	Associate	11854362, 15117956
Uterine Cervical Neoplasms	Associate	33928605, 9499067
Uterine Cervical Neoplasms	Inhibit	36694148
Uveal melanoma	Associate	40550050
Varicose Ulcer	Associate	27400471

CEBPB (CCAAT enhancer binding protein beta)