Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10498
Gene name Gene Name - the full gene name approved by the HGNC.
Coactivator associated arginine methyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CARM1
Synonyms (NCBI Gene) Gene synonyms aliases
PRMT4
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated protein
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051469 hsa-let-7e-5p CLASH 23622248
MIRT049639 hsa-miR-92a-3p CLASH 23622248
MIRT054424 hsa-miR-15a-5p Luciferase reporter assay, qRT-PCR, Western blot 24530761
MIRT054424 hsa-miR-15a-5p Luciferase reporter assay, qRT-PCR, Western blot 24530761
MIRT054424 hsa-miR-15a-5p Luciferase reporter assay, qRT-PCR, Western blot 24530761
Transcription factors
Transcription factor Regulation Reference
NFKB1 Unknown 20462455
RELA Unknown 20462455
TP53 Unknown 20462455
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding ISS
GO:0003713 Function Transcription coactivator activity ISS
GO:0005515 Function Protein binding IPI 16938873, 20111005, 21911467, 23455924, 24434208, 24498420, 26267537
GO:0005634 Component Nucleus IDA 15221992
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603934 23393 ENSG00000142453
Protein
UniProt ID Q86X55
Protein name Histone-arginine methyltransferase CARM1 (EC 2.1.1.319) (Coactivator-associated arginine methyltransferase 1) (Protein arginine N-methyltransferase 4)
Protein function Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, pre-mRNA splicing, and mRNA stability (PubMed:12237300, PubMed:16497732, PubMed:
PDB 2Y1W , 2Y1X , 4IKP , 5DWQ , 5DX0 , 5DX1 , 5DX8 , 5DXA , 5DXJ , 5U4X , 6ARJ , 6ARV , 6D2L , 6DVR , 6IZQ , 6S70 , 6S71 , 6S74 , 6S77 , 6S79 , 6S7A , 6S7B , 6S7C , 7FAI , 7FAJ , 7U9I , 8G2H , 8G2I , 8SIG , 8SIH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11531 CARM1 28 139 Coactivator-associated arginine methyltransferase 1 N terminal Domain
PF06325 PrmA 173 286 Family
Tissue specificity TISSUE SPECIFICITY: Overexpressed in prostate adenocarcinomas and high-grade prostatic intraepithelial neoplasia. {ECO:0000269|PubMed:15221992}.
Sequence
MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEV
RAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSF
YNILKTCRGHTLERSVFSE
RTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNH
TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPG
KVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMF
PTIGDVHLAPFTDE
QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFL
EAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTT
PSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLAN
TGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
TNTMHYGS
Sequence length 608
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocrine resistance   RORA activates gene expression
PPARA activates gene expression
Transcriptional activation of mitochondrial biogenesis
Activation of gene expression by SREBF (SREBP)
RMTs methylate histone arginines
Transcriptional regulation of white adipocyte differentiation
Regulation of lipid metabolism by PPARalpha
Circadian Clock
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
Estrogen-dependent gene expression
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Hypercholesterolemia Hypercholesterolemia, Familial rs28942111, rs28942112, rs137852912, rs121908025, rs28942082, rs28942083, rs121908028, rs121908030, rs28942079, rs28942084, rs121908032, rs387906302, rs387906303, rs121908033, rs121908034
View all (1161 more)
22968135
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 23143594
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 15221992, 23915145
Adenocarcinoma of Lung Associate 33593309
Adenoma Associate 38509667
Breast Neoplasms Associate 21612300, 23585185, 23663560, 23915145, 26030442, 28432361, 28537268, 31657716, 31833203, 33782401, 34663249
Carcinogenesis Associate 35033016
Carcinoma Hepatocellular Associate 29991055, 34522186
Carcinoma Non Small Cell Lung Associate 32425504
Carcinoma Ovarian Epithelial Associate 32004442
Cardiomyopathies Associate 35383293
Colorectal Neoplasms Associate 21478268, 28345460, 32140074, 37997821