Gene Gene information from NCBI Gene database.
Entrez ID 10498
Gene name Coactivator associated arginine methyltransferase 1
Gene symbol CARM1
Synonyms (NCBI Gene)
PRMT4
Chromosome 19
Chromosome location 19p13.2
Summary This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated protein
miRNA miRNA information provided by mirtarbase database.
371
miRTarBase ID miRNA Experiments Reference
MIRT051469 hsa-let-7e-5p CLASH 23622248
MIRT049639 hsa-miR-92a-3p CLASH 23622248
MIRT054424 hsa-miR-15a-5p Luciferase reporter assayqRT-PCRWestern blot 24530761
MIRT054424 hsa-miR-15a-5p Luciferase reporter assayqRT-PCRWestern blot 24530761
MIRT054424 hsa-miR-15a-5p Luciferase reporter assayqRT-PCRWestern blot 24530761
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
NFKB1 Unknown 20462455
RELA Unknown 20462455
TP53 Unknown 20462455
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
48
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription cis-regulatory region binding ISS
GO:0003713 Function Transcription coactivator activity IDA 15471871
GO:0003713 Function Transcription coactivator activity ISS
GO:0005515 Function Protein binding IPI 16938873, 20111005, 21911467, 23455924, 24434208, 24498420, 26267537, 33412112, 33961781
GO:0005634 Component Nucleus IDA 15221992
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603934 23393 ENSG00000142453
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86X55
Protein name Histone-arginine methyltransferase CARM1 (EC 2.1.1.319) (Coactivator-associated arginine methyltransferase 1) (Protein arginine N-methyltransferase 4)
Protein function Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, pre-mRNA splicing, and mRNA stability (PubMed:12237300, PubMed:16497732, PubMed:
PDB 2Y1W , 2Y1X , 4IKP , 5DWQ , 5DX0 , 5DX1 , 5DX8 , 5DXA , 5DXJ , 5U4X , 6ARJ , 6ARV , 6D2L , 6DVR , 6IZQ , 6S70 , 6S71 , 6S74 , 6S77 , 6S79 , 6S7A , 6S7B , 6S7C , 7FAI , 7FAJ , 7U9I , 8G2H , 8G2I , 8SIG , 8SIH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11531 CARM1 28 139 Coactivator-associated arginine methyltransferase 1 N terminal Domain
PF06325 PrmA 173 286 Family
Tissue specificity TISSUE SPECIFICITY: Overexpressed in prostate adenocarcinomas and high-grade prostatic intraepithelial neoplasia. {ECO:0000269|PubMed:15221992}.
Sequence
MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEV
RAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSF
YNILKTCRGHTLERSVFSE
RTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNH
TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPG
KVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMF
PTIGDVHLAPFTDE
QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFL
EAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTT
PSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLAN
TGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
TNTMHYGS
Sequence length 608
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Endocrine resistance   RORA activates gene expression
PPARA activates gene expression
Transcriptional activation of mitochondrial biogenesis
Activation of gene expression by SREBF (SREBP)
RMTs methylate histone arginines
Transcriptional regulation of white adipocyte differentiation
Regulation of lipid metabolism by PPARalpha
Circadian Clock
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
Estrogen-dependent gene expression
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Neurodevelopmental disorder Uncertain significance rs2513483699 RCV004586508
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 15221992, 23915145
Adenocarcinoma of Lung Associate 33593309
Adenoma Associate 38509667
Breast Neoplasms Associate 21612300, 23585185, 23663560, 23915145, 26030442, 28432361, 28537268, 31657716, 31833203, 33782401, 34663249
Carcinogenesis Associate 35033016
Carcinoma Hepatocellular Associate 29991055, 34522186
Carcinoma Non Small Cell Lung Associate 32425504
Carcinoma Ovarian Epithelial Associate 32004442
Cardiomyopathies Associate 35383293
Colorectal Neoplasms Associate 21478268, 28345460, 32140074, 37997821