Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10494
Gene name Gene Name - the full gene name approved by the HGNC.
Serine/threonine kinase 25
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STK25
Synonyms (NCBI Gene) Gene synonyms aliases
SOK1, YSK1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q37.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the germinal centre kinase III (GCK III) subfamily of the sterile 20 superfamily of kinases. The encoded enzyme plays a role in serine-threonine liver kinase B1 (LKB1) signaling pathway to regulate neuronal polarization and m
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049469 hsa-miR-92a-3p CLASH 23622248
MIRT044928 hsa-miR-186-5p CLASH 23622248
MIRT723640 hsa-miR-4681 HITS-CLIP 19536157
MIRT723639 hsa-miR-1179 HITS-CLIP 19536157
MIRT723638 hsa-miR-4310 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004672 Function Protein kinase activity TAS 9160885
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0004674 Function Protein serine/threonine kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602255 11404 ENSG00000115694
Protein
UniProt ID O00506
Protein name Serine/threonine-protein kinase 25 (EC 2.7.11.1) (Ste20-like kinase) (Sterile 20/oxidant stress-response kinase 1) (SOK-1) (Ste20/oxidant stress response kinase 1)
Protein function Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important
PDB 2XIK , 3W8H , 4NZW , 7Z4V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 20 270 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Highest levels are found in testis, large intestine, brain and stomach followed by heart and lung.
Sequence
MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEI
EDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATI
LREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPF
WMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHS
KPFKEFVEACLNKDPRFRPTAKELLKHKFI
TRYTKKTSFLTELIDRYKRWKSEGHGEESS
SEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLST
LVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRN
HLTSTR
Sequence length 426
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertension Hypertension N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 34795841
Colorectal Neoplasms Associate 38166604
Developmental Disabilities Associate 26238961, 38098057
Epilepsy Associate 26238961
Genetic Diseases Inborn Associate 38098057
Leukemia Myeloid Acute Associate 36708053
Microcephaly Associate 26238961
Neoplasms Associate 25550858
Prostatic Hyperplasia Associate 25550858
Prostatic Neoplasms Associate 25550858