Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10488
Gene name	CAMP responsive element binding protein 3
Gene symbol	CREB3
Synonyms (NCBI Gene)	LUMANLZIPsLZIP
Chromosome	9
Chromosome location	9p13.3
Summary	This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also as

Show/Hide all (67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019911	hsa-miR-375	Microarray	20215506
MIRT908625	hsa-miR-1976	CLIP-seq
MIRT908626	hsa-miR-3155	CLIP-seq
MIRT908627	hsa-miR-3155b	CLIP-seq
MIRT908628	hsa-miR-370	CLIP-seq
MIRT908629	hsa-miR-4329	CLIP-seq
MIRT908630	hsa-miR-4663	CLIP-seq
MIRT908631	hsa-miR-4786-5p	CLIP-seq
MIRT908632	hsa-miR-484	CLIP-seq
MIRT908633	hsa-miR-769-5p	CLIP-seq
MIRT1969290	hsa-miR-4520a-3p	CLIP-seq
MIRT1969291	hsa-miR-4520b-3p	CLIP-seq
MIRT1969292	hsa-miR-4529-3p	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2508657	hsa-miR-1225-3p	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2508658	hsa-miR-1233	CLIP-seq
MIRT2508659	hsa-miR-1280	CLIP-seq
MIRT2508660	hsa-miR-129-3p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2508661	hsa-miR-3194-5p	CLIP-seq
MIRT2508662	hsa-miR-3650	CLIP-seq
MIRT2508663	hsa-miR-3660	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2508664	hsa-miR-4264	CLIP-seq
MIRT2508665	hsa-miR-4526	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2508666	hsa-miR-4687-5p	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2508667	hsa-miR-595	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq
MIRT2508657	hsa-miR-1225-3p	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2508658	hsa-miR-1233	CLIP-seq
MIRT2508659	hsa-miR-1280	CLIP-seq
MIRT2508660	hsa-miR-129-3p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2508661	hsa-miR-3194-5p	CLIP-seq
MIRT2508662	hsa-miR-3650	CLIP-seq
MIRT2508663	hsa-miR-3660	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2508664	hsa-miR-4264	CLIP-seq
MIRT1969291	hsa-miR-4520b-3p	CLIP-seq
MIRT2508665	hsa-miR-4526	CLIP-seq
MIRT1969292	hsa-miR-4529-3p	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2508666	hsa-miR-4687-5p	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2508667	hsa-miR-595	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17296613
RELA	Unknown	17296613

Show/Hide all (71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	20091349
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	15845366, 16940180
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16940180
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	16940180
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	11711630
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16940180
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16940180
GO:0001558	Process	Regulation of cell growth	IDA	20141198
GO:0003677	Function	DNA binding	IDA	9271389, 10675342
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	16940180
GO:0003700	Function	DNA-binding transcription factor activity	IDA	10675342, 20141198
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	9271389, 10629049, 10675342, 10871379, 15001559, 15705566, 17483474, 18391022, 20102225, 20195357, 20546900, 21516116, 23661758, 25910212, 29547901, 31515488, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10675342, 16940180, 19779205, 20141198, 20546900
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	18391022, 19779205, 20091349
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	10623756, 10675342
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	IMP	10623756
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	20091349, 20546900
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	IMP	10623756
GO:0005829	Component	Cytosol	IMP	15001559
GO:0006351	Process	DNA-templated transcription	IDA	9271389
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0006935	Process	Chemotaxis	IEA
GO:0006986	Process	Response to unfolded protein	IEA
GO:0008140	Function	CAMP response element binding protein binding	IDA	9271389
GO:0016020	Component	Membrane	IDA	19779205
GO:0016020	Component	Membrane	IDA	10623756, 19779205
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA	18391022
GO:0019046	Process	Release from viral latency	TAS	10623756
GO:0030335	Process	Positive regulation of cell migration	IMP	15001559
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	16940180, 18391022
GO:0031726	Function	CCR1 chemokine receptor binding	IDA	15001559
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	15845366
GO:0042127	Process	Regulation of cell population proliferation	IMP	10675342
GO:0042802	Function	Identical protein binding	IPI	21516116, 23661758
GO:0042803	Function	Protein homodimerization activity	IDA	10675342, 20141198
GO:0042981	Process	Regulation of apoptotic process	IDA	16940180
GO:0043025	Component	Neuronal cell body	IDA	20091349
GO:0045786	Process	Negative regulation of cell cycle	NAS	10623756
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9271389
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15845366, 16940180, 17296613, 18391022, 20141198
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16940180
GO:0046983	Function	Protein dimerization activity	TAS	10623756
GO:0050930	Process	Induction of positive chemotaxis	IDA	19779205
GO:0050930	Process	Induction of positive chemotaxis	IDA	19779205
GO:0050930	Process	Induction of positive chemotaxis	IMP	15001559
GO:0051928	Process	Positive regulation of calcium ion transport	IMP	15001559
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	17296613
GO:0090045	Process	Positive regulation of deacetylase activity	IDA	19779205
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	16940180
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
606443	2347	ENSG00000107175

O43889

Protein name

Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Lu

Protein function

Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription (PubMed:10984507, PubMed:15845366, PubMed:16940180, PubMed:19779205, PubMed:9271389). Plays a role in the unfolded protei

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	148 → 211	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:19779205, PubMed:9271389). Expressed in dendritic cells (DC). Weakly expressed in monocytes (at protein level) (PubMed:20546900). {ECO:0000269|PubMed:19779205, ECO:0000269|PubMed:20546900, ECO:0000269|Pub

Sequence

MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSP
PASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARL
VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
RVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
LLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGS
PSVILQDRYSG

Sequence length

371

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway cAMP signaling pathway PI3K-Akt signaling pathway AMPK signaling pathway Longevity regulating pathway Adrenergic signaling in cardiomyocytes TNF signaling pathway Thermogenesis Cholinergic synapse Dopaminergic synapse Insulin secretion Estrogen signaling pathway Melanogenesis Thyroid hormone synthesis Glucagon signaling pathway Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Insulin resistance Cushing syndrome Growth hormone synthesis, secretion and action Vasopressin-regulated water reabsorption Huntington disease Prion disease Cocaine addiction Amphetamine addiction Alcoholism Hepatitis B Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Viral carcinogenesis Chemical carcinogenesis - receptor activation Prostate cancer		CREB3 factors activate genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Breast ductal adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Bipolar Disorder	Associate	18189280	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	20473547, 28662179	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	23023215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	38151984	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Associate	23023215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	32820009, 36284436	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	27163161	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	26747525	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Associate	38151984	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	22009750	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22009750, 24481121, 34828279	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	23023215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Duct Calculi	Associate	23023215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	22009750, 24481121	★★★★★ ★☆☆☆☆ Found in Text Mining only
Virus Diseases	Associate	30232260	★★★★★ ★☆☆☆☆ Found in Text Mining only

CREB3 (cAMP responsive element binding protein 3)