Gene Gene information from NCBI Gene database.
Entrez ID 10487
Gene name Cyclase associated actin cytoskeleton regulatory protein 1
Gene symbol CAP1
Synonyms (NCBI Gene)
CAPCAP1-PEN
Chromosome 1
Chromosome location 1p34.2
Summary The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively splice
miRNA miRNA information provided by mirtarbase database.
618
miRTarBase ID miRNA Experiments Reference
MIRT002798 hsa-miR-1-3p pSILAC 18668040
MIRT002798 hsa-miR-1-3p Microarray 15685193
MIRT002798 hsa-miR-1-3p Microarray 15685193
MIRT002798 hsa-miR-1-3p Proteomics 18668040
MIRT027489 hsa-miR-98-5p Microarray 19088304
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IBA
GO:0000902 Process Cell morphogenesis IEA
GO:0001667 Process Ameboidal-type cell migration IEA
GO:0003779 Function Actin binding IBA
GO:0003779 Function Actin binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617801 20040 ENSG00000131236
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q01518
Protein name Adenylyl cyclase-associated protein 1 (CAP 1)
Protein function Directly regulates filament dynamics and has been implicated in a number of complex developmental and morphological processes, including mRNA localization and the establishment of cell polarity.
PDB 1K8F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01213 CAP_N 5 62 Adenylate cyclase associated (CAP) N terminal Family
PF08603 CAP_C 318 473 Adenylate cyclase associated (CAP) C terminal Family
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLK
IS
KEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPP
PVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPF
SAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTT
LQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEI
AG
Sequence length 475
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs34497744 RCV005903413
Clear cell carcinoma of kidney Benign rs34497744 RCV005903414
Lung cancer Benign rs34497744 RCV005903418
Malignant lymphoma, large B-cell, diffuse Benign rs34497744 RCV005903415
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 25691058
Alzheimer Disease Associate 38071202
Arthritis Rheumatoid Associate 29191223
beta Thalassemia Associate 27228385, 40121643
Breast Neoplasms Associate 32560703
Carcinoma Hepatocellular Associate 34290294, 35931200
Carcinoma Non Small Cell Lung Associate 34148878
Carcinoma Ovarian Epithelial Associate 25652936
Chest Pain Associate 37773847
Glomerulonephritis IGA Associate 28831120