Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10481
Gene name Gene Name - the full gene name approved by the HGNC.	Homeobox B13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HOXB13
Synonyms (NCBI Gene) Gene synonyms aliases	HPC9, PSGD
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HPC9
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin d

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs77179853	A>-	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Frameshift variant, stop lost, terminator codon variant
rs138213197	C>T	Pathogenic, pathogenic-likely-pathogenic, risk-factor, likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019730	hsa-miR-375	Microarray	20215506
MIRT490314	hsa-miR-1321	PAR-CLIP	23592263
MIRT490312	hsa-miR-4739	PAR-CLIP	23592263
MIRT490311	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT490310	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT490309	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT490308	hsa-miR-4285	PAR-CLIP	23592263
MIRT490307	hsa-miR-4419a	PAR-CLIP	23592263
MIRT490306	hsa-miR-4510	PAR-CLIP	23592263
MIRT490305	hsa-miR-6127	PAR-CLIP	23592263
MIRT490304	hsa-miR-6129	PAR-CLIP	23592263
MIRT490303	hsa-miR-6130	PAR-CLIP	23592263
MIRT490302	hsa-miR-6133	PAR-CLIP	23592263
MIRT490301	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490300	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490299	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490298	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490297	hsa-miR-193b-5p	PAR-CLIP	23592263
MIRT490296	hsa-miR-629-5p	PAR-CLIP	23592263
MIRT490295	hsa-miR-299-5p	PAR-CLIP	23592263
MIRT490314	hsa-miR-1321	PAR-CLIP	23592263
MIRT490312	hsa-miR-4739	PAR-CLIP	23592263
MIRT490311	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT490310	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT490309	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT490308	hsa-miR-4285	PAR-CLIP	23592263
MIRT490307	hsa-miR-4419a	PAR-CLIP	23592263
MIRT490306	hsa-miR-4510	PAR-CLIP	23592263
MIRT490305	hsa-miR-6127	PAR-CLIP	23592263
MIRT490304	hsa-miR-6129	PAR-CLIP	23592263
MIRT490303	hsa-miR-6130	PAR-CLIP	23592263
MIRT490302	hsa-miR-6133	PAR-CLIP	23592263
MIRT490301	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490300	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490299	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490298	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490297	hsa-miR-193b-5p	PAR-CLIP	23592263
MIRT490296	hsa-miR-629-5p	PAR-CLIP	23592263
MIRT490295	hsa-miR-299-5p	PAR-CLIP	23592263
MIRT1053286	hsa-miR-105	CLIP-seq
MIRT1053287	hsa-miR-1197	CLIP-seq
MIRT1053288	hsa-miR-1207-5p	CLIP-seq
MIRT1053289	hsa-miR-1343	CLIP-seq
MIRT1053290	hsa-miR-214	CLIP-seq
MIRT1053291	hsa-miR-2355-5p	CLIP-seq
MIRT1053292	hsa-miR-3065-5p	CLIP-seq
MIRT1053293	hsa-miR-3189-3p	CLIP-seq
MIRT1053294	hsa-miR-328	CLIP-seq
MIRT1053295	hsa-miR-3619-5p	CLIP-seq
MIRT1053296	hsa-miR-3663-5p	CLIP-seq
MIRT1053297	hsa-miR-4286	CLIP-seq
MIRT1053298	hsa-miR-4291	CLIP-seq
MIRT1053299	hsa-miR-4436a	CLIP-seq
MIRT1053300	hsa-miR-4733-5p	CLIP-seq
MIRT1053301	hsa-miR-4736	CLIP-seq
MIRT1053302	hsa-miR-4763-3p	CLIP-seq
MIRT1053303	hsa-miR-495	CLIP-seq
MIRT1053304	hsa-miR-657	CLIP-seq
MIRT1053305	hsa-miR-761	CLIP-seq
MIRT1053306	hsa-miR-922	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT2012135	hsa-miR-1915	CLIP-seq
MIRT2012136	hsa-miR-3120-5p	CLIP-seq
MIRT2012137	hsa-miR-3150b-3p	CLIP-seq
MIRT2012138	hsa-miR-3667-3p	CLIP-seq
MIRT2012139	hsa-miR-4646-5p	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT2012140	hsa-miR-4726-3p	CLIP-seq
MIRT2012141	hsa-miR-4768-3p	CLIP-seq
MIRT2012142	hsa-miR-4784	CLIP-seq
MIRT2012143	hsa-miR-483-3p	CLIP-seq
MIRT2012144	hsa-miR-665	CLIP-seq
MIRT1053286	hsa-miR-105	CLIP-seq
MIRT2244376	hsa-miR-1207-3p	CLIP-seq
MIRT2244377	hsa-miR-1910	CLIP-seq
MIRT1053292	hsa-miR-3065-5p	CLIP-seq
MIRT2244378	hsa-miR-3661	CLIP-seq
MIRT2244379	hsa-miR-377	CLIP-seq
MIRT2244380	hsa-miR-4251	CLIP-seq
MIRT2244381	hsa-miR-4264	CLIP-seq
MIRT2244382	hsa-miR-4268	CLIP-seq
MIRT1053297	hsa-miR-4286	CLIP-seq
MIRT2244383	hsa-miR-4313	CLIP-seq
MIRT2244384	hsa-miR-4446-5p	CLIP-seq
MIRT2244385	hsa-miR-455-3p	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT2244386	hsa-miR-4755-5p	CLIP-seq
MIRT1053303	hsa-miR-495	CLIP-seq
MIRT2244387	hsa-miR-5096	CLIP-seq
MIRT2244388	hsa-miR-539	CLIP-seq
MIRT2244389	hsa-miR-579	CLIP-seq
MIRT2244390	hsa-miR-631	CLIP-seq
MIRT2244391	hsa-miR-642a	CLIP-seq
MIRT2244392	hsa-miR-661	CLIP-seq
MIRT2244393	hsa-miR-767-5p	CLIP-seq
MIRT2244394	hsa-miR-9	CLIP-seq
MIRT2389122	hsa-miR-137	CLIP-seq
MIRT2389123	hsa-miR-1468	CLIP-seq
MIRT2389124	hsa-miR-1827	CLIP-seq
MIRT2389125	hsa-miR-3064-3p	CLIP-seq
MIRT2389126	hsa-miR-4252	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT2389127	hsa-miR-4715-3p	CLIP-seq
MIRT2389128	hsa-miR-574-5p	CLIP-seq
MIRT2389129	hsa-miR-759	CLIP-seq
MIRT2451331	hsa-miR-122	CLIP-seq
MIRT2451332	hsa-miR-1292	CLIP-seq
MIRT2451333	hsa-miR-3122	CLIP-seq
MIRT2451334	hsa-miR-3165	CLIP-seq
MIRT2451335	hsa-miR-3913-5p	CLIP-seq
MIRT2451336	hsa-miR-4456	CLIP-seq
MIRT2451337	hsa-miR-4471	CLIP-seq
MIRT2244394	hsa-miR-9	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
EZH2	Repression	22808286
HDAC4	Repression	19013255
YY1	Repression	19013255

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15126340
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15126340
GO:0001525	Process	Angiogenesis	IEP	17972163
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008327	Function	Methyl-CpG binding	IDA	28473536
GO:0008544	Process	Epidermis development	TAS	9665387
GO:0009611	Process	Response to wounding	TAS	9665387
GO:0033574	Process	Response to testosterone	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0060527	Process	Prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA
GO:0060743	Process	Epithelial cell maturation involved in prostate gland development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
604607	5112	ENSG00000159184

Protein

UniProt ID

Q92826

Protein name

Homeobox protein Hox-B13

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds preferentially to methylated DNA (PubMed:28473536). {ECO:0000

PDB

2CRA , 5EDN , 5EEA , 5EF6 , 5EG0 , 5EGO , 5NO6 , 7PSX , 8BYX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12284	HoxA13_N	12 → 123	Hox protein A13 N terminal	Family
PF00046	Homeodomain	217 → 273	Homeodomain	Domain

Sequence

MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPP
KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEY
PSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNS
QMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKF
ITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP

Sequence length

284

Interactions

View interactions

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	24239177
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	24239177
Colonic neoplasms	Malignant tumor of colon	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	24239177
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	17145863
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828 View all (31 more)
Prostate cancer	Malignant neoplasm of prostate, Prostate carcinoma, Prostate cancer, familial, Familial prostate cancer	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	24239177, 22714738, 23104005, 24390282, 23292082, 25629170, 26457646, 27424772, 22236224, 23064873, 29892016
Prostate cancer, hereditary	Prostate Cancer, Hereditary, 9, PROSTATE CANCER, HEREDITARY, 1	rs387906327, rs193929331, rs74315365, rs397516896, rs794729219, rs121913349, rs587782641, rs1114167673, rs1597371666, rs2073394466	22236224

Show/Hide Text Mining Associations (49)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	31882852, 34609407
Adenocarcinoma of Lung	Associate	31558162
Breast Neoplasms	Stimulate	15193263
Breast Neoplasms	Associate	18499701, 19250546, 21559019, 21574054, 22293681, 23099437, 23497539, 23812955, 25640367, 26728744, 27424772
Calcinosis Cutis	Associate	29716922, 35031163, 36446039
Carcinogenesis	Associate	19793339, 25743797, 26108461, 32376288
Carcinoma Basal Cell	Associate	32830201
Carcinoma Hepatocellular	Associate	25031711
Carcinoma Renal Cell	Associate	33619226, 39331921
Colorectal Neoplasms	Inhibit	15928669
Colorectal Neoplasms	Associate	23541221, 30541551, 33099213, 36356413, 37434131
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	36356413
Congenital thrombotic disease due to Protein C deficiency	Associate	31273254
Drug Related Side Effects and Adverse Reactions	Associate	31878059
Ependymoma	Associate	19793339
Esophageal Squamous Cell Carcinoma	Associate	27956498, 30082829, 33693959, 39596630
Hereditary Breast and Ovarian Cancer Syndrome	Associate	18499701, 27899188
Hereditary pancreatitis	Associate	33423702
Inflammatory Bowel Diseases	Associate	35557042
Kidney Neoplasms	Associate	33619226
Leukemia	Associate	26108461, 33099213
Lymphatic Metastasis	Associate	18499701, 30541551, 35296171
Lymphatic Metastasis	Stimulate	34609407
Mental Disorders	Associate	23318356
Neoplasm Metastasis	Associate	25031711, 25640367, 27497761, 31273254, 32540218, 32690948, 33514011, 35296171, 35468964, 38236581
Neoplasm Metastasis	Inhibit	35468964
Neoplasms	Inhibit	15928669, 31273254, 33619226, 34396425
Neoplasms	Associate	16445654, 18499701, 20504375, 22293681, 23064873, 24550738, 24722062, 25031711, 25287138, 25629170, 25825985, 26108461, 26261579, 26457646, 28186998 View all (13 more)
Niemann Pick Disease Type C	Associate	36597889
Ovarian Neoplasms	Associate	25944620, 35639251
Pancreatic Neoplasms	Associate	26261579
Papilloma	Associate	25743797
Polyps	Associate	33423702
Prostate cancer familial	Associate	22236224, 22714738, 23396964, 23457453, 24722062, 25595936, 27899188, 28272408, 28790484, 31556563, 34059701
Prostate Cancer Hereditary 7	Associate	30181389, 37806842
Prostatic Neoplasms	Associate	15583692, 17280610, 19917249, 20504375, 22236224, 22293681, 22714738, 22718278, 22808286, 23036981, 23064873, 23099437, 23104005, 23129385, 23318356 View all (67 more)
Prostatic Neoplasms Castration Resistant	Associate	27497761, 29844167, 35849143
Prostatitis	Associate	24148311, 24456780, 26108461, 26176944, 26457646, 28186998, 29844167, 31735626, 33531604, 35849143, 38112617
Pyruvate Carboxylase Deficiency Disease	Associate	31556563
Rectal Neoplasms	Associate	35296171
Rhabdoid Tumor	Stimulate	32376288
Schizotypal Personality Disorder	Associate	21574054
Skin Neoplasms	Associate	32830201
Squamous Cell Carcinoma of Head and Neck	Associate	28808656, 33315534, 37245006
Stomach Diseases	Associate	34864309
Stomach Neoplasms	Associate	33099213, 34396425, 34864309
Thyroid Cancer Papillary	Associate	24189220
Urinary Bladder Neoplasms	Associate	24189220, 26108461
Uterine Cervical Neoplasms	Associate	16445654, 16803519, 25743797, 28402266, 33099213

HOXB13 (homeobox B13)