ATP5PD (ATP synthase peripheral stalk subunit d)

Gene

• Entrez ID: 10476
• Gene name: ATP synthase peripheral stalk subunit d
• Gene symbol: ATP5PD
• Synonyms (NCBI Gene): APT5H, ATP5H, ATPQ
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000274	Component	Mitochondrial proton-transporting ATP synthase, stator stalk	IBA	21873635
GO:0005515	Function	Protein binding	IPI	19688755, 30021884
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	IDA
GO:0005743	Component	Mitochondrial inner membrane	IDA	19016746
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005753	Component	Mitochondrial proton-transporting ATP synthase complex	IDA	12110673
GO:0006754	Process	ATP biosynthetic process	TAS
GO:0015986	Process	ATP synthesis coupled proton transport	IBA	21873635
GO:0042407	Process	Cristae formation	TAS
GO:0042776	Process	Mitochondrial ATP synthesis coupled proton transport	IDA	12110673
GO:0042776	Process	Mitochondrial ATP synthesis coupled proton transport	TAS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046933	Function	Proton-transporting ATP synthase activity, rotational mechanism	IDA	12110673
GO:1901653	Process	Cellular response to peptide	IEA

Other IDs

• MIM: 618121
• HGNC: 845
• e!Ensembl: ENSG00000167863

Protein

• UniProt ID: O75947
• Protein name: ATP synthase peripheral stalk subunit d, mitochondrial (ATPase subunit d) (ATP synthase peripheral stalk subunit d)
• Protein function: Subunit d, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the resp
• PDB: 8H9F, 8H9G, 8H9J, 8H9K, 8H9M, 8H9N, 8H9Q, 8H9R, 8H9S, 8H9T, 8H9U, 8H9V, 8KHF, 8KI3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05873	Mt_ATP-synt_D	3 → 155	ATP synthase D chain, mitochondrial (ATP5H)	Family

• Sequence:

  MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKAN
  VAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEME
  KMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

• Sequence length: 161

Pathways

KEGG:

Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Reactome:

Formation of ATP by chemiosmotic coupling
Cristae formation

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370, rs760043106, rs1057519788, rs1131692238, rs1131692237, rs1554350382	19381893

Unknown
Disease term	Disease name	Evidence	References	Source
Bipolar Disorder	Bipolar Disorder			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
COVID 19	Associate	38259479
Insomnia Fatal Familial	Associate	27338255
Irritable Bowel Syndrome	Associate	30614852
Mitochondrial Diseases	Associate	33615715
Pre Eclampsia	Associate	38259479
Renal Insufficiency	Associate	33615715