Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10468
Gene name Gene Name - the full gene name approved by the HGNC.
Follistatin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FST
Synonyms (NCBI Gene) Gene synonyms aliases
FS
Disease Acronyms (UniProt) Disease acronyms from UniProt database
FS
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicin
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1005519 hsa-miR-33a CLIP-seq
MIRT1005520 hsa-miR-33b CLIP-seq
MIRT1005521 hsa-miR-3679-3p CLIP-seq
MIRT1005522 hsa-miR-4446-5p CLIP-seq
MIRT1005521 hsa-miR-3679-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
BRCA1 Activation 22685544
CTNNB1 Unknown 24667650
GLI2 Activation 18319260
SMAD3 Activation 24330518
TCF4 Unknown 24667650
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12702211
GO:0001501 Process Skeletal system development IEA
GO:0002244 Process Hematopoietic progenitor cell differentiation IDA 15451575
GO:0005515 Function Protein binding IPI 16198295, 17991437, 20860622, 32296183
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
136470 3971 ENSG00000134363
Protein
UniProt ID P19883
Protein name Follistatin (FS) (Activin-binding protein)
Protein function Multifunctional regulatory protein whose primary function is to antagonize members of the transforming growth factor beta (TGF-beta) superfamily including activin, myostatin, GDF11 or bone morphogenetic proteins (BMPs) (PubMed:11279126, PubMed:1
PDB 2B0U , 2P6A , 3HH2 , 5JHW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09289 FOLN 95 116 Follistatin/Osteonectin-like EGF domain Domain
PF07648 Kazal_2 117 164 Kazal-type serine protease inhibitor domain Domain
PF07648 Kazal_2 191 239 Kazal-type serine protease inhibitor domain Domain
PF07648 Kazal_2 269 316 Kazal-type serine protease inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is the predominant isoform in serum but is undetectable in follicular fluid. In the embryo, strong expression is seen in the palatal epithelia, including the medial edge epithelial and midline epithelial seam of the palatal s
Sequence
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRC
KKTCRDVFCPGSSTCV
VDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI
KAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEA
ACSSGVLLEVKHSGSC
NSISEDTEEEEEDEDQDYSFPISSILEW
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  TGF-beta signaling pathway   Antagonism of Activin by Follistatin
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
16298037
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
16298037
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)
16367923
Liver failure Liver Failure, Acute rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116
View all (10 more)
12560755
Unknown
Disease term Disease name Evidence References Source
Coenzyme Q10 Deficiency Coenzyme Q10 Deficiency GWAS
Diabetes Diabetes GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Gout Gout GWAS
Associations from Text Mining
Disease Name Relationship Type References
Abortion Spontaneous Inhibit 17074342
Adenocarcinoma Associate 25347573, 25885021
Adenocarcinoma of Lung Associate 25347573
Adenoma Stimulate 23010638
Adenomyosis Associate 26086422
Allergic Fungal Sinusitis Associate 26030615
Breast Diseases Associate 19740438
Breast Neoplasms Associate 24667650
Breast Neoplasms Inhibit 28647698
Carcinoma Hepatocellular Stimulate 26189841