Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10467
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger HIT-type containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNHIT1
Synonyms (NCBI Gene) Gene synonyms aliases	CG1I, ZNFN4A1, p18(Hamlet)
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029663	hsa-miR-26b-5p	Microarray	19088304
MIRT1542907	hsa-miR-1324	CLIP-seq
MIRT1542908	hsa-miR-1915	CLIP-seq
MIRT1542909	hsa-miR-2467-5p	CLIP-seq
MIRT1542910	hsa-miR-3119	CLIP-seq
MIRT1542911	hsa-miR-3188	CLIP-seq
MIRT1542912	hsa-miR-3663-5p	CLIP-seq
MIRT1542913	hsa-miR-3975	CLIP-seq
MIRT1542914	hsa-miR-4316	CLIP-seq
MIRT1542915	hsa-miR-4433	CLIP-seq
MIRT1542916	hsa-miR-4722-3p	CLIP-seq
MIRT1542917	hsa-miR-4726-3p	CLIP-seq
MIRT1542918	hsa-miR-485-5p	CLIP-seq
MIRT1542919	hsa-miR-637	CLIP-seq
MIRT1542920	hsa-miR-665	CLIP-seq
MIRT2163780	hsa-miR-1343	CLIP-seq
MIRT1542909	hsa-miR-2467-5p	CLIP-seq
MIRT2163781	hsa-miR-3074-5p	CLIP-seq
MIRT2163782	hsa-miR-3124-3p	CLIP-seq
MIRT1542911	hsa-miR-3188	CLIP-seq
MIRT2163783	hsa-miR-3617	CLIP-seq
MIRT1542912	hsa-miR-3663-5p	CLIP-seq
MIRT1542913	hsa-miR-3975	CLIP-seq
MIRT1542914	hsa-miR-4316	CLIP-seq
MIRT1542918	hsa-miR-485-5p	CLIP-seq
MIRT2163784	hsa-miR-641	CLIP-seq
MIRT1542919	hsa-miR-637	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000812	Component	Swr1 complex	IBA	21873635
GO:0005515	Function	Protein binding	IPI	15647280, 16230350, 17380123, 17577209, 17892483, 18624398, 20473270, 24463511, 25416956, 28514442, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	17892483
GO:0005654	Component	Nucleoplasm	IDA
GO:0031491	Function	Nucleosome binding	IBA	21873635
GO:0043486	Process	Histone exchange	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
618617	21688	ENSG00000106400

Protein

UniProt ID

O43257

Protein name

Zinc finger HIT domain-containing protein 1 (Cyclin-G1-binding protein 1) (Zinc finger protein subfamily 4A member 1) (p18 Hamlet)

Protein function

Plays a role in chromatin remodeling by promoting the incorporation of histone variant H2AZ1/H2A.Z into the genome to regulate gene expression (PubMed:20473270, PubMed:35175558). Promotes SRCAP complex-mediated deposition of histone variant H2AZ

PDB

8X15 , 8X19 , 8X1C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04438	zf-HIT	113 → 142	HIT zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine. {ECO:0000269|PubMed:17892483}.

Sequence

MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDD
DADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVC
GFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

Sequence length

154

Interactions

View interactions

	KEGG
	ATP-dependent chromatin remodeling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Mitochondrial Diseases	Inhibit	35175558, 37178741
Parkinson Disease	Associate	35175558, 37178741

ZNHIT1 (zinc finger HIT-type containing 1)