Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10467
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger HIT-type containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNHIT1
Synonyms (NCBI Gene) Gene synonyms aliases	CG1I, ZNFN4A1, p18(Hamlet)
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029663	hsa-miR-26b-5p	Microarray	19088304
MIRT1542907	hsa-miR-1324	CLIP-seq
MIRT1542908	hsa-miR-1915	CLIP-seq
MIRT1542909	hsa-miR-2467-5p	CLIP-seq
MIRT1542910	hsa-miR-3119	CLIP-seq
MIRT1542911	hsa-miR-3188	CLIP-seq
MIRT1542912	hsa-miR-3663-5p	CLIP-seq
MIRT1542913	hsa-miR-3975	CLIP-seq
MIRT1542914	hsa-miR-4316	CLIP-seq
MIRT1542915	hsa-miR-4433	CLIP-seq
MIRT1542916	hsa-miR-4722-3p	CLIP-seq
MIRT1542917	hsa-miR-4726-3p	CLIP-seq
MIRT1542918	hsa-miR-485-5p	CLIP-seq
MIRT1542919	hsa-miR-637	CLIP-seq
MIRT1542920	hsa-miR-665	CLIP-seq
MIRT2163780	hsa-miR-1343	CLIP-seq
MIRT1542909	hsa-miR-2467-5p	CLIP-seq
MIRT2163781	hsa-miR-3074-5p	CLIP-seq
MIRT2163782	hsa-miR-3124-3p	CLIP-seq
MIRT1542911	hsa-miR-3188	CLIP-seq
MIRT2163783	hsa-miR-3617	CLIP-seq
MIRT1542912	hsa-miR-3663-5p	CLIP-seq
MIRT1542913	hsa-miR-3975	CLIP-seq
MIRT1542914	hsa-miR-4316	CLIP-seq
MIRT1542918	hsa-miR-485-5p	CLIP-seq
MIRT2163784	hsa-miR-641	CLIP-seq
MIRT1542919	hsa-miR-637	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000786	Component	Nucleosome	NAS	16634648
GO:0000812	Component	Swr1 complex	IBA
GO:0003015	Process	Heart process	IEA
GO:0003015	Process	Heart process	ISS
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	15647280, 16230350, 17380123, 17577209, 17892483, 18624398, 20473270, 24463511, 25416956, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	17892483
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	ISS
GO:0006338	Process	Chromatin remodeling	NAS	16634648
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	16634648
GO:0008270	Function	Zinc ion binding	IEA
GO:0031491	Function	Nucleosome binding	IBA
GO:0036335	Process	Intestinal stem cell homeostasis	IEA
GO:0036335	Process	Intestinal stem cell homeostasis	ISS
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042393	Function	Histone binding	IPI	20473270
GO:0042692	Process	Muscle cell differentiation	IMP	20473270
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	IDA	17700068
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0055074	Process	Calcium ion homeostasis	ISS
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IEA
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	ISS
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:0070317	Process	Negative regulation of G0 to G1 transition	IEA
GO:1905458	Process	Positive regulation of lymphoid progenitor cell differentiation	IEA
GO:1905458	Process	Positive regulation of lymphoid progenitor cell differentiation	ISS

MIM	HGNC	e!Ensembl
618617	21688	ENSG00000106400

Protein

UniProt ID

O43257

Protein name

Zinc finger HIT domain-containing protein 1 (Cyclin-G1-binding protein 1) (Zinc finger protein subfamily 4A member 1) (p18 Hamlet)

Protein function

Plays a role in chromatin remodeling by promoting the incorporation of histone variant H2AZ1/H2A.Z into the genome to regulate gene expression (PubMed:20473270, PubMed:35175558). Promotes SRCAP complex-mediated deposition of histone variant H2AZ

PDB

8X15 , 8X19 , 8X1C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04438	zf-HIT	113 → 142	HIT zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine. {ECO:0000269|PubMed:17892483}.

Sequence

MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDD
DADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVC
GFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

Sequence length

154

Interactions

View interactions

	KEGG
	ATP-dependent chromatin remodeling

ZNHIT1 (zinc finger HIT-type containing 1)