ZNHIT1 (zinc finger HIT-type containing 1)

Gene

• Entrez ID: 10467
• Gene name: Zinc finger HIT-type containing 1
• Gene symbol: ZNHIT1
• Synonyms (NCBI Gene): CG1I, ZNFN4A1, p18(Hamlet)
• Chromosome: 7
• Chromosome location: 7q22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029663	hsa-miR-26b-5p	Microarray	19088304
MIRT1542907	hsa-miR-1324	CLIP-seq
MIRT1542908	hsa-miR-1915	CLIP-seq
MIRT1542909	hsa-miR-2467-5p	CLIP-seq
MIRT1542910	hsa-miR-3119	CLIP-seq
MIRT1542911	hsa-miR-3188	CLIP-seq
MIRT1542912	hsa-miR-3663-5p	CLIP-seq
MIRT1542913	hsa-miR-3975	CLIP-seq
MIRT1542914	hsa-miR-4316	CLIP-seq
MIRT1542915	hsa-miR-4433	CLIP-seq
MIRT1542916	hsa-miR-4722-3p	CLIP-seq
MIRT1542917	hsa-miR-4726-3p	CLIP-seq
MIRT1542918	hsa-miR-485-5p	CLIP-seq
MIRT1542919	hsa-miR-637	CLIP-seq
MIRT1542920	hsa-miR-665	CLIP-seq
MIRT2163780	hsa-miR-1343	CLIP-seq
MIRT1542909	hsa-miR-2467-5p	CLIP-seq
MIRT2163781	hsa-miR-3074-5p	CLIP-seq
MIRT2163782	hsa-miR-3124-3p	CLIP-seq
MIRT1542911	hsa-miR-3188	CLIP-seq
MIRT2163783	hsa-miR-3617	CLIP-seq
MIRT1542912	hsa-miR-3663-5p	CLIP-seq
MIRT1542913	hsa-miR-3975	CLIP-seq
MIRT1542914	hsa-miR-4316	CLIP-seq
MIRT1542918	hsa-miR-485-5p	CLIP-seq
MIRT2163784	hsa-miR-641	CLIP-seq
MIRT1542919	hsa-miR-637	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000786	Component	Nucleosome	NAS	16634648
GO:0000812	Component	Swr1 complex	IBA
GO:0003015	Process	Heart process	IEA
GO:0003015	Process	Heart process	ISS
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	15647280, 16230350, 17380123, 17577209, 17892483, 18624398, 20473270, 24463511, 25416956, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	17892483
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	ISS
GO:0006338	Process	Chromatin remodeling	NAS	16634648
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	16634648
GO:0008270	Function	Zinc ion binding	IEA
GO:0031491	Function	Nucleosome binding	IBA
GO:0036335	Process	Intestinal stem cell homeostasis	IEA
GO:0036335	Process	Intestinal stem cell homeostasis	ISS
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042393	Function	Histone binding	IPI	20473270
GO:0042692	Process	Muscle cell differentiation	IMP	20473270
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	IDA	17700068
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0055074	Process	Calcium ion homeostasis	ISS
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IEA
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	ISS
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:0070317	Process	Negative regulation of G0 to G1 transition	IEA
GO:1905458	Process	Positive regulation of lymphoid progenitor cell differentiation	IEA
GO:1905458	Process	Positive regulation of lymphoid progenitor cell differentiation	ISS

Other IDs

• MIM: 618617
• HGNC: 21688
• e!Ensembl: ENSG00000106400

Protein

• UniProt ID: O43257
• Protein name: Zinc finger HIT domain-containing protein 1 (Cyclin-G1-binding protein 1) (Zinc finger protein subfamily 4A member 1) (p18 Hamlet)
• Protein function: Plays a role in chromatin remodeling by promoting the incorporation of histone variant H2AZ1/H2A.Z into the genome to regulate gene expression (PubMed:20473270, PubMed:35175558). Promotes SRCAP complex-mediated deposition of histone variant H2AZ
• PDB: 8X15, 8X19, 8X1C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04438	zf-HIT	113 → 142	HIT zinc finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine. {ECO:0000269|PubMed:17892483}.
• Sequence:

  MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDD
  DADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVC
  GFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

• Sequence length: 154

Pathways

KEGG:

ATP-dependent chromatin remodeling