Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10460
Gene name Gene Name - the full gene name approved by the HGNC.	Transforming acidic coiled-coil containing protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TACC3
Synonyms (NCBI Gene) Gene synonyms aliases	ERIC-1, ERIC1, Tacc4, maskin
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the transforming acidic colied-coil protein family. The encoded protein is a motor spindle protein that may play a role in stabilization of the mitotic spindle. This protein may also play a role in growth a differentiation of

Show/Hide all(85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016566	hsa-miR-193b-3p	Microarray	20304954
MIRT045607	hsa-miR-149-5p	CLASH	23622248
MIRT043259	hsa-miR-324-5p	CLASH	23622248
MIRT042910	hsa-miR-324-3p	CLASH	23622248
MIRT016566	hsa-miR-193b-3p	CLASH	23622248
MIRT040904	hsa-miR-18a-3p	CLASH	23622248
MIRT039103	hsa-miR-769-3p	CLASH	23622248
MIRT037681	hsa-miR-744-5p	CLASH	23622248
MIRT438423	hsa-miR-425-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438422	hsa-miR-152-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438421	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438423	hsa-miR-425-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438422	hsa-miR-152-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438421	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT489756	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT489755	hsa-miR-4706	PAR-CLIP	23592263
MIRT489754	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT489753	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT489752	hsa-miR-663a	PAR-CLIP	23592263
MIRT489750	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT489751	hsa-miR-3180	PAR-CLIP	23592263
MIRT489749	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT489748	hsa-miR-3196	PAR-CLIP	23592263
MIRT489747	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT489746	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT489745	hsa-miR-4488	PAR-CLIP	23592263
MIRT489744	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT489743	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT489742	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT489756	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT489755	hsa-miR-4706	PAR-CLIP	23592263
MIRT489754	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT489753	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT489752	hsa-miR-663a	PAR-CLIP	23592263
MIRT489750	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT489751	hsa-miR-3180	PAR-CLIP	23592263
MIRT489749	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT489748	hsa-miR-3196	PAR-CLIP	23592263
MIRT489747	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT489746	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT489745	hsa-miR-4488	PAR-CLIP	23592263
MIRT489744	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT489743	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT489742	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT1408451	hsa-miR-1305	CLIP-seq
MIRT1408452	hsa-miR-1324	CLIP-seq
MIRT1408453	hsa-miR-1908	CLIP-seq
MIRT1408454	hsa-miR-1909	CLIP-seq
MIRT1408455	hsa-miR-2277-3p	CLIP-seq
MIRT1408456	hsa-miR-3123	CLIP-seq
MIRT1408457	hsa-miR-330-3p	CLIP-seq
MIRT1408458	hsa-miR-3605-3p	CLIP-seq
MIRT1408459	hsa-miR-4307	CLIP-seq
MIRT1408460	hsa-miR-4436a	CLIP-seq
MIRT1408461	hsa-miR-4461	CLIP-seq
MIRT1408462	hsa-miR-4496	CLIP-seq
MIRT1408463	hsa-miR-4700-3p	CLIP-seq
MIRT1408464	hsa-miR-483-5p	CLIP-seq
MIRT1408465	hsa-miR-488	CLIP-seq
MIRT1408466	hsa-miR-607	CLIP-seq
MIRT1408467	hsa-miR-627	CLIP-seq
MIRT1408468	hsa-miR-663	CLIP-seq
MIRT1408452	hsa-miR-1324	CLIP-seq
MIRT1408453	hsa-miR-1908	CLIP-seq
MIRT1408454	hsa-miR-1909	CLIP-seq
MIRT1408455	hsa-miR-2277-3p	CLIP-seq
MIRT1408456	hsa-miR-3123	CLIP-seq
MIRT1408458	hsa-miR-3605-3p	CLIP-seq
MIRT1408460	hsa-miR-4436a	CLIP-seq
MIRT1408463	hsa-miR-4700-3p	CLIP-seq
MIRT1408464	hsa-miR-483-5p	CLIP-seq
MIRT1408468	hsa-miR-663	CLIP-seq
MIRT1408452	hsa-miR-1324	CLIP-seq
MIRT1408455	hsa-miR-2277-3p	CLIP-seq
MIRT1408456	hsa-miR-3123	CLIP-seq
MIRT1408460	hsa-miR-4436a	CLIP-seq
MIRT1408463	hsa-miR-4700-3p	CLIP-seq
MIRT1408464	hsa-miR-483-5p	CLIP-seq
MIRT1408452	hsa-miR-1324	CLIP-seq
MIRT1408455	hsa-miR-2277-3p	CLIP-seq
MIRT1408456	hsa-miR-3123	CLIP-seq
MIRT1408458	hsa-miR-3605-3p	CLIP-seq
MIRT1408460	hsa-miR-4436a	CLIP-seq
MIRT1408463	hsa-miR-4700-3p	CLIP-seq
MIRT1408464	hsa-miR-483-5p	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA	21873635
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	20360068, 21297582, 25416956, 26496610, 29892012, 32296183
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0007052	Process	Mitotic spindle organization	IEA
GO:0007091	Process	Metaphase/anaphase transition of mitotic cell cycle	IMP	23532825
GO:0008283	Process	Cell population proliferation	IBA	21873635
GO:0021987	Process	Cerebral cortex development	IBA	21873635
GO:0034451	Component	Centriolar satellite	IDA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0051301	Process	Cell division	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	21297582
GO:0072686	Component	Mitotic spindle	IDA
GO:1902850	Process	Microtubule cytoskeleton organization involved in mitosis	IMP	23532825

MIM	HGNC	e!Ensembl
605303	11524	ENSG00000013810

Protein

UniProt ID

Q9Y6A5

Protein name

Transforming acidic coiled-coil-containing protein 3 (ERIC-1)

Protein function

Plays a role in the microtubule-dependent coupling of the nucleus and the centrosome. Involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors (By similarity). Acts as a component of

PDB

5LXN , 5LXO , 5ODS , 5ODT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05010	TACC_C	639 → 832	Transforming acidic coiled-coil-containing protein (TACC), C-terminal	Coiled-coil

Sequence

MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQK
PVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQ
AVEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGG
VCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTLTCAHTSAPE
STAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKRAPPPRRLGER
SGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDWDKMDDPNFIPFGG
DTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAE
TPTAESKERALNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDY
LEQFGTSSFKESALRKQSLYLKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPREAKL
VEFDFLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVKATQEENRELRS
RCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAEIQKVLKEKDQLTTDLNSMEK
SFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQLANE
EIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI

Sequence length

838

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (60)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Stimulate	22869527
Adamantinoma	Associate	29241927
Adenocarcinoma	Stimulate	34134633
Adenocarcinoma of Lung	Associate	35855850
Aneuploidy	Associate	28855393
Breast Neoplasms	Associate	36864125
Brenner Tumor	Associate	33077920
Carcinogenesis	Associate	28855393, 33714201
Carcinoma	Associate	25188299
Carcinoma Hepatocellular	Associate	26219398, 26219896
Carcinoma Neuroendocrine	Associate	34247193
Carcinoma Non Small Cell Lung	Associate	27956147, 35855850, 36142417
Carcinoma Renal Cell	Associate	33714201
Carcinoma Squamous Cell	Associate	24323028
Cholangiocarcinoma	Associate	24563076
Cleft Lip	Associate	29241927
Colorectal Neoplasms	Associate	36221072
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	29241927
Emanuel syndrome	Stimulate	15198734
Endometrial Neoplasms	Associate	29588307
Epilepsies Partial	Associate	30220708
Esophageal Squamous Cell Carcinoma	Associate	25535896, 25760075
Facial Dysmorphism with Multiple Malformations	Associate	29241927
Ganglioglioma	Associate	36647073
Genetic Diseases Inborn	Associate	29241927, 32416892
Glioblastoma	Associate	21113414, 27829236, 29361062, 31290679, 32949176, 33168106, 33853673, 35151844, 36002559, 36194351, 36647073
Glioma	Associate	21113414, 25135958, 28379477, 28976058, 32413119, 32949176, 34160364, 36647073
Glioma	Stimulate	28273854
Hematologic Neoplasms	Associate	32199932
Leukemia Myeloid Acute	Associate	32402250
Lung Neoplasms	Associate	25535896, 36042187
Lymphatic Metastasis	Associate	36221072
Lymphoma Non Hodgkin	Associate	36647073
Melanoma	Associate	32493317
Multiple Myeloma	Associate	15198734, 23522059
Nasopharyngeal Carcinoma	Associate	25535896
Neoplasm Metastasis	Associate	36221072
Neoplasms	Associate	17914111, 20348956, 22869527, 24121792, 26219398, 28273854, 28379477, 28855393, 28912153, 29135996, 29358577, 30024460, 32402250, 34134633, 35151844, 36042187 View all (1 more)
Neoplasms	Inhibit	36864125
Neoplasms Neuroepithelial	Associate	36647073
Non Muscle Invasive Bladder Neoplasms	Stimulate	29358577
Non Muscle Invasive Bladder Neoplasms	Associate	40603902
Nonsyndromic Holoprosencephaly	Associate	34134633
Oculocutaneous albinism type 2	Stimulate	33714201
Osteosarcoma	Associate	30024460
Personality Disorders	Associate	26219896
Prodromal Symptoms	Stimulate	33714201
Rectal Neoplasms	Associate	30341253
Respiratory Tract Infections	Associate	32208524
Roberts Syndrome	Associate	29241927
Sarcoma	Associate	29135996, 30024460
Thyroid Carcinoma Anaplastic	Inhibit	17914111
Thyroid Neoplasms	Inhibit	17914111
Triple Negative Breast Neoplasms	Associate	27231203, 40179432
Urinary Bladder Diseases	Associate	28855393
Urinary Bladder Neoplasms	Associate	20348956, 21459758, 24121792, 26374428, 32384449, 33213418, 34160364, 35151844
Urinary Bladder Neoplasms	Inhibit	28855393
Urinary Bladder Neoplasms	Stimulate	29358577
Uterine Cervical Neoplasms	Associate	23936413, 25669975
Wolf Hirschhorn Syndrome	Associate	29241927, 32416892

TACC3 (transforming acidic coiled-coil containing protein 3)