Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10459
Gene name Gene Name - the full gene name approved by the HGNC.
Mitotic arrest deficient 2 like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MAD2L2
Synonyms (NCBI Gene) Gene synonyms aliases
FANCV, MAD2B, POLZ2, REV7
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable o
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1057517674 A>C,T Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002570 hsa-miR-124-3p Microarray 18668037
MIRT002570 hsa-miR-124-3p Microarray 15685193
MIRT047029 hsa-miR-187-3p CLASH 23622248
MIRT036379 hsa-miR-1229-3p CLASH 23622248
MIRT1125092 hsa-miR-1324 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 19443654
GO:0000785 Component Chromatin NAS 29656893
GO:0001558 Process Regulation of cell growth IGI 15988022
GO:0002208 Process Somatic diversification of immunoglobulins involved in immune response NAS 29656893
GO:0003714 Function Transcription corepressor activity IMP 19443654
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604094 6764 ENSG00000116670
Protein
UniProt ID Q9UI95
Protein name Mitotic spindle assembly checkpoint protein MAD2B (Mitotic arrest deficient 2-like protein 2) (MAD2-like protein 2) (REV7 homolog) (hREV7)
Protein function Adapter protein able to interact with different proteins and involved in different biological processes (PubMed:11459825, PubMed:11459826, PubMed:17296730, PubMed:17719540, PubMed:19443654, PubMed:29656893). Mediates the interaction between the
PDB 3ABD , 3ABE , 3VU7 , 4EXT , 4GK0 , 4GK5 , 5XPT , 5XPU , 6BC8 , 6BCD , 6BI7 , 6K07 , 6K08 , 6KEA , 6KTO , 6M7A , 6M7B , 6NIF , 6VE5 , 6WS0 , 6WS5 , 6WW9 , 6WWA , 7L9P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02301 HORMA 16 135 HORMA domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:11717438}.
Sequence
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDA
VLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Sequence length 211
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Bacterial invasion of epithelial cells
  Translesion synthesis by REV1
Translesion synthesis by POLK
Translesion synthesis by POLI
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Fanconi Anemia Fanconi anemia, Fanconi anemia complementation group V N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anemia Hemolytic Associate 31915374
Aortic Dissection Associate 37684281
Breast Neoplasms Stimulate 27712588
Cap Myopathy Associate 26987799
Carcinogenesis Associate 27712588
Carcinoma Hepatocellular Associate 38049741
Chromosome Aberrations Associate 23303771
Colorectal Neoplasms Associate 34278473, 36012568, 40018943
Colorectal Neoplasms Inhibit 38167649
Dyskinesia Drug Induced Associate 34599261