Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10458
Gene name Gene Name - the full gene name approved by the HGNC.
BAR/IMD domain containing adaptor protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BAIAP2
Synonyms (NCBI Gene) Gene synonyms aliases
BAP2, FLAF3, IRSP53, WAML
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor ty
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037874 hsa-miR-455-3p CLASH 23622248
MIRT815462 hsa-miR-1237 CLIP-seq
MIRT815463 hsa-miR-15a CLIP-seq
MIRT815464 hsa-miR-15b CLIP-seq
MIRT815465 hsa-miR-16 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001221 Function Transcription coregulator binding IEA
GO:0001726 Component Ruffle IEA
GO:0005515 Function Protein binding IPI 11130076, 11157984, 11696321, 12598619, 15289329, 16189514, 17003044, 18448434, 19171758, 19460367, 19564905, 19933840, 20936779, 21311754, 21893288, 24076653, 24189400, 24584464, 24658140, 24705354, 25416956, 25519916, 25814554, 26496610, 28514442, 31980649, 32296183, 32814053, 339
GO:0005515 Function Protein binding TAS 10343108
GO:0005654 Component Nucleoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605475 947 ENSG00000175866
Protein
UniProt ID Q9UQB8
Protein name BAR/IMD domain-containing adapter protein 2 (Brain-specific angiogenesis inhibitor 1-associated protein 2) (BAI-associated protein 2) (BAI1-associated protein 2) (Protein BAP2) (Fas ligand-associated factor 3) (FLAF3) (Insulin receptor substrate p53/p58)
Protein function Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin c
PDB 1WDZ , 1Y2O , 2YKT , 3RNJ , 4JS0 , 6BCR , 6BCY , 6BD1 , 6BD2 , 6BQT , 6ZEG , 6ZEI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08397 IMD 17 237 IRSp53/MIM homology domain Family
PF07653 SH3_2 378 435 Variant SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 4 are expressed almost exclusively in brain. Isoform 4 is barely detectable in placenta, prostate and testis. A short isoform is ubiquitous, with the highest expression in liver, prostate, testis and placenta. {EC
Sequence
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIP
ERA
VQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN
GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKT
LPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
TKMRGWFPFSYTRVL
DSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPA
QTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGRE
HGDGSARTLAGR
Sequence length 552
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Adherens junction
Regulation of actin cytoskeleton
Pathogenic Escherichia coli infection
Yersinia infection
  Regulation of actin dynamics for phagocytic cup formation
VEGFA-VEGFR2 Pathway
RHO GTPases Activate WASPs and WAVEs
FCGR3A-mediated phagocytosis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast cancer Breast cancer N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Inhibit 23537733
Attention Deficit Disorder with Hyperactivity Associate 24377651, 28938222
Auditory Perceptual Disorders Associate 24377651
Breast Neoplasms Associate 29871690, 33216456
Carcinoma Hepatocellular Stimulate 34616498
Cognition Disorders Associate 37211381
Colorectal Neoplasms Associate 35159257
Depressive Disorder Associate 32681239
Esophageal Squamous Cell Carcinoma Associate 32375686
Hemochromatosis Associate 27285756