Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10457
Gene name Gene Name - the full gene name approved by the HGNC.	Glycoprotein nmb
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPNMB
Synonyms (NCBI Gene) Gene synonyms aliases	HGFIN, NMB, PLCA3
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p15.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show

Show/Hide all(6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs140352180	C>A,T	Pathogenic	Synonymous variant, stop gained, coding sequence variant
rs747723062	TG>-	Pathogenic	Frameshift variant, coding sequence variant
rs763065333	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs770211260	T>C,G	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs773435101	GTTT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554300664	A>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(210)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030247	hsa-miR-26b-5p	Microarray	19088304
MIRT731326	hsa-miR-508-5p	Luciferase reporter assay	27003587
MIRT731326	hsa-miR-508-5p	Luciferase reporter assay	27003587
MIRT2005502	hsa-miR-3649	CLIP-seq
MIRT2005503	hsa-miR-548aa	CLIP-seq
MIRT2005504	hsa-miR-548ac	CLIP-seq
MIRT2005505	hsa-miR-548d-3p	CLIP-seq
MIRT2005506	hsa-miR-548z	CLIP-seq
MIRT2005507	hsa-miR-935	CLIP-seq
MIRT2542146	hsa-miR-1206	CLIP-seq
MIRT2542147	hsa-miR-1224-3p	CLIP-seq
MIRT2542148	hsa-miR-1254	CLIP-seq
MIRT2542149	hsa-miR-1260	CLIP-seq
MIRT2542150	hsa-miR-1260b	CLIP-seq
MIRT2542151	hsa-miR-127-5p	CLIP-seq
MIRT2542152	hsa-miR-128	CLIP-seq
MIRT2542153	hsa-miR-1280	CLIP-seq
MIRT2542154	hsa-miR-140-3p	CLIP-seq
MIRT2542155	hsa-miR-183	CLIP-seq
MIRT2542156	hsa-miR-205	CLIP-seq
MIRT2542157	hsa-miR-22	CLIP-seq
MIRT2542158	hsa-miR-2355-5p	CLIP-seq
MIRT2542159	hsa-miR-2861	CLIP-seq
MIRT2542160	hsa-miR-3116	CLIP-seq
MIRT2542161	hsa-miR-3119	CLIP-seq
MIRT2542162	hsa-miR-3129-3p	CLIP-seq
MIRT2542163	hsa-miR-3140-3p	CLIP-seq
MIRT2542164	hsa-miR-3148	CLIP-seq
MIRT2542165	hsa-miR-3157-5p	CLIP-seq
MIRT2542166	hsa-miR-3163	CLIP-seq
MIRT2542167	hsa-miR-320a	CLIP-seq
MIRT2542168	hsa-miR-320b	CLIP-seq
MIRT2542169	hsa-miR-320c	CLIP-seq
MIRT2542170	hsa-miR-320d	CLIP-seq
MIRT2542171	hsa-miR-323b-5p	CLIP-seq
MIRT2542172	hsa-miR-338-3p	CLIP-seq
MIRT2542173	hsa-miR-338-5p	CLIP-seq
MIRT2542174	hsa-miR-342-3p	CLIP-seq
MIRT2542175	hsa-miR-3609	CLIP-seq
MIRT2542176	hsa-miR-361-5p	CLIP-seq
MIRT2542177	hsa-miR-3616-5p	CLIP-seq
MIRT2542178	hsa-miR-3646	CLIP-seq
MIRT2542179	hsa-miR-3647-5p	CLIP-seq
MIRT2542180	hsa-miR-3654	CLIP-seq
MIRT2542181	hsa-miR-3659	CLIP-seq
MIRT2542182	hsa-miR-3688-3p	CLIP-seq
MIRT2542183	hsa-miR-378	CLIP-seq
MIRT2542184	hsa-miR-378b	CLIP-seq
MIRT2542185	hsa-miR-378c	CLIP-seq
MIRT2542186	hsa-miR-378d	CLIP-seq
MIRT2542187	hsa-miR-378e	CLIP-seq
MIRT2542188	hsa-miR-378f	CLIP-seq
MIRT2542189	hsa-miR-378h	CLIP-seq
MIRT2542190	hsa-miR-378i	CLIP-seq
MIRT2542191	hsa-miR-382	CLIP-seq
MIRT2542192	hsa-miR-3923	CLIP-seq
MIRT2542193	hsa-miR-3973	CLIP-seq
MIRT2542194	hsa-miR-3978	CLIP-seq
MIRT2542195	hsa-miR-410	CLIP-seq
MIRT2542196	hsa-miR-422a	CLIP-seq
MIRT2542197	hsa-miR-4272	CLIP-seq
MIRT2542198	hsa-miR-4303	CLIP-seq
MIRT2542199	hsa-miR-4310	CLIP-seq
MIRT2542200	hsa-miR-4328	CLIP-seq
MIRT2542201	hsa-miR-433	CLIP-seq
MIRT2542202	hsa-miR-4429	CLIP-seq
MIRT2542203	hsa-miR-4432	CLIP-seq
MIRT2542204	hsa-miR-4433	CLIP-seq
MIRT2542205	hsa-miR-4438	CLIP-seq
MIRT2542206	hsa-miR-4453	CLIP-seq
MIRT2542207	hsa-miR-4459	CLIP-seq
MIRT2542208	hsa-miR-4496	CLIP-seq
MIRT2542209	hsa-miR-451b	CLIP-seq
MIRT2542210	hsa-miR-4530	CLIP-seq
MIRT2542211	hsa-miR-4538	CLIP-seq
MIRT2542212	hsa-miR-4637	CLIP-seq
MIRT2542213	hsa-miR-4639-5p	CLIP-seq
MIRT2542214	hsa-miR-4654	CLIP-seq
MIRT2542215	hsa-miR-4658	CLIP-seq
MIRT2542216	hsa-miR-4666-5p	CLIP-seq
MIRT2542217	hsa-miR-4682	CLIP-seq
MIRT2542218	hsa-miR-4691-3p	CLIP-seq
MIRT2542219	hsa-miR-4693-3p	CLIP-seq
MIRT2542220	hsa-miR-4712-3p	CLIP-seq
MIRT2542221	hsa-miR-4729	CLIP-seq
MIRT2542222	hsa-miR-4738-3p	CLIP-seq
MIRT2542223	hsa-miR-4762-3p	CLIP-seq
MIRT2542224	hsa-miR-4763-5p	CLIP-seq
MIRT2542225	hsa-miR-4768-3p	CLIP-seq
MIRT2542226	hsa-miR-4769-5p	CLIP-seq
MIRT2542227	hsa-miR-4774-5p	CLIP-seq
MIRT2542228	hsa-miR-4795-5p	CLIP-seq
MIRT2542229	hsa-miR-4802-3p	CLIP-seq
MIRT2542230	hsa-miR-4803	CLIP-seq
MIRT2542231	hsa-miR-487a	CLIP-seq
MIRT2542232	hsa-miR-491-3p	CLIP-seq
MIRT2542233	hsa-miR-494	CLIP-seq
MIRT2542234	hsa-miR-499-5p	CLIP-seq
MIRT2542235	hsa-miR-512-5p	CLIP-seq
MIRT2542236	hsa-miR-513b	CLIP-seq
MIRT2542237	hsa-miR-532-3p	CLIP-seq
MIRT2542238	hsa-miR-548ah	CLIP-seq
MIRT2542239	hsa-miR-548t	CLIP-seq
MIRT2542240	hsa-miR-573	CLIP-seq
MIRT2542241	hsa-miR-574-5p	CLIP-seq
MIRT2542242	hsa-miR-582-5p	CLIP-seq
MIRT2542243	hsa-miR-586	CLIP-seq
MIRT2542244	hsa-miR-595	CLIP-seq
MIRT2542245	hsa-miR-624	CLIP-seq
MIRT2542246	hsa-miR-627	CLIP-seq
MIRT2542247	hsa-miR-633	CLIP-seq
MIRT2542248	hsa-miR-635	CLIP-seq
MIRT2542249	hsa-miR-642a	CLIP-seq
MIRT2542250	hsa-miR-648	CLIP-seq
MIRT2542251	hsa-miR-651	CLIP-seq
MIRT2542252	hsa-miR-660	CLIP-seq
MIRT2542253	hsa-miR-661	CLIP-seq
MIRT2542254	hsa-miR-668	CLIP-seq
MIRT2542255	hsa-miR-766	CLIP-seq
MIRT2542256	hsa-miR-924	CLIP-seq
MIRT2005507	hsa-miR-935	CLIP-seq
MIRT2542146	hsa-miR-1206	CLIP-seq
MIRT2542147	hsa-miR-1224-3p	CLIP-seq
MIRT2542148	hsa-miR-1254	CLIP-seq
MIRT2542149	hsa-miR-1260	CLIP-seq
MIRT2542150	hsa-miR-1260b	CLIP-seq
MIRT2542153	hsa-miR-1280	CLIP-seq
MIRT2542154	hsa-miR-140-3p	CLIP-seq
MIRT2542155	hsa-miR-183	CLIP-seq
MIRT2542158	hsa-miR-2355-5p	CLIP-seq
MIRT2542159	hsa-miR-2861	CLIP-seq
MIRT2542160	hsa-miR-3116	CLIP-seq
MIRT2542161	hsa-miR-3119	CLIP-seq
MIRT2542162	hsa-miR-3129-3p	CLIP-seq
MIRT2542164	hsa-miR-3148	CLIP-seq
MIRT2542165	hsa-miR-3157-5p	CLIP-seq
MIRT2542166	hsa-miR-3163	CLIP-seq
MIRT2542171	hsa-miR-323b-5p	CLIP-seq
MIRT2542172	hsa-miR-338-3p	CLIP-seq
MIRT2542173	hsa-miR-338-5p	CLIP-seq
MIRT2542174	hsa-miR-342-3p	CLIP-seq
MIRT2542175	hsa-miR-3609	CLIP-seq
MIRT2542177	hsa-miR-3616-5p	CLIP-seq
MIRT2542179	hsa-miR-3647-5p	CLIP-seq
MIRT2542180	hsa-miR-3654	CLIP-seq
MIRT2542181	hsa-miR-3659	CLIP-seq
MIRT2542182	hsa-miR-3688-3p	CLIP-seq
MIRT2542183	hsa-miR-378	CLIP-seq
MIRT2542184	hsa-miR-378b	CLIP-seq
MIRT2542185	hsa-miR-378c	CLIP-seq
MIRT2542186	hsa-miR-378d	CLIP-seq
MIRT2542187	hsa-miR-378e	CLIP-seq
MIRT2542188	hsa-miR-378f	CLIP-seq
MIRT2542189	hsa-miR-378h	CLIP-seq
MIRT2542190	hsa-miR-378i	CLIP-seq
MIRT2542193	hsa-miR-3973	CLIP-seq
MIRT2542194	hsa-miR-3978	CLIP-seq
MIRT2542195	hsa-miR-410	CLIP-seq
MIRT2542196	hsa-miR-422a	CLIP-seq
MIRT2542197	hsa-miR-4272	CLIP-seq
MIRT2542198	hsa-miR-4303	CLIP-seq
MIRT2542199	hsa-miR-4310	CLIP-seq
MIRT2542201	hsa-miR-433	CLIP-seq
MIRT2542204	hsa-miR-4433	CLIP-seq
MIRT2542205	hsa-miR-4438	CLIP-seq
MIRT2542206	hsa-miR-4453	CLIP-seq
MIRT2542207	hsa-miR-4459	CLIP-seq
MIRT2542208	hsa-miR-4496	CLIP-seq
MIRT2542209	hsa-miR-451b	CLIP-seq
MIRT2542210	hsa-miR-4530	CLIP-seq
MIRT2542211	hsa-miR-4538	CLIP-seq
MIRT2542212	hsa-miR-4637	CLIP-seq
MIRT2542214	hsa-miR-4654	CLIP-seq
MIRT2542215	hsa-miR-4658	CLIP-seq
MIRT2542216	hsa-miR-4666-5p	CLIP-seq
MIRT2542217	hsa-miR-4682	CLIP-seq
MIRT2542218	hsa-miR-4691-3p	CLIP-seq
MIRT2542219	hsa-miR-4693-3p	CLIP-seq
MIRT2542220	hsa-miR-4712-3p	CLIP-seq
MIRT2542221	hsa-miR-4729	CLIP-seq
MIRT2542222	hsa-miR-4738-3p	CLIP-seq
MIRT2542223	hsa-miR-4762-3p	CLIP-seq
MIRT2542225	hsa-miR-4768-3p	CLIP-seq
MIRT2542226	hsa-miR-4769-5p	CLIP-seq
MIRT2542227	hsa-miR-4774-5p	CLIP-seq
MIRT2542228	hsa-miR-4795-5p	CLIP-seq
MIRT2542229	hsa-miR-4802-3p	CLIP-seq
MIRT2542231	hsa-miR-487a	CLIP-seq
MIRT2542232	hsa-miR-491-3p	CLIP-seq
MIRT2542235	hsa-miR-512-5p	CLIP-seq
MIRT2542237	hsa-miR-532-3p	CLIP-seq
MIRT2542238	hsa-miR-548ah	CLIP-seq
MIRT2542239	hsa-miR-548t	CLIP-seq
MIRT2542240	hsa-miR-573	CLIP-seq
MIRT2542241	hsa-miR-574-5p	CLIP-seq
MIRT2542242	hsa-miR-582-5p	CLIP-seq
MIRT2542243	hsa-miR-586	CLIP-seq
MIRT2542244	hsa-miR-595	CLIP-seq
MIRT2542245	hsa-miR-624	CLIP-seq
MIRT2542246	hsa-miR-627	CLIP-seq
MIRT2542247	hsa-miR-633	CLIP-seq
MIRT2542248	hsa-miR-635	CLIP-seq
MIRT2542250	hsa-miR-648	CLIP-seq
MIRT2542251	hsa-miR-651	CLIP-seq
MIRT2542252	hsa-miR-660	CLIP-seq
MIRT2542253	hsa-miR-661	CLIP-seq
MIRT2542254	hsa-miR-668	CLIP-seq
MIRT2542255	hsa-miR-766	CLIP-seq
MIRT2542256	hsa-miR-924	CLIP-seq
MIRT2005507	hsa-miR-935	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
MITF	Activation	18983539
TP53	Unknown	15684612

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IDA	19350579
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IEA
GO:0005515	Function	Protein binding	IPI	12609765, 26751287
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IMP	19350579
GO:0007267	Process	Cell-cell signaling	IMP	19350579
GO:0008201	Function	Heparin binding	IDA	19350579
GO:0008201	Function	Heparin binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7814155
GO:0016020	Component	Membrane	IDA	12609765
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7814155
GO:0030335	Process	Positive regulation of cell migration	IDA	20711474
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0033162	Component	Melanosome membrane	IEA
GO:0034103	Process	Regulation of tissue remodeling	IDA	25010402
GO:0034103	Process	Regulation of tissue remodeling	IEA
GO:0042056	Function	Chemoattractant activity	NAS	20711474
GO:0042130	Process	Negative regulation of T cell proliferation	IDA	19350579
GO:0045545	Function	Syndecan binding	IPI	19350579
GO:0045765	Process	Regulation of angiogenesis	NAS	20711474
GO:0048018	Function	Receptor ligand activity	IMP	19350579
GO:0050868	Process	Negative regulation of T cell activation	IMP	19350579
GO:0050918	Process	Positive chemotaxis	NAS	20711474
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	TAS	22891158
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IDA	19350579

MIM	HGNC	e!Ensembl
604368	4462	ENSG00000136235

Protein

UniProt ID

Q14956

Protein name

Transmembrane glycoprotein NMB (Hematopoietic growth factor inducible neurokinin-1 type)

Protein function

Could be a melanogenic enzyme.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00801	PKD	270 → 321	PKD domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, but very low expression, if any, in the brain (PubMed:12609765, PubMed:16609006). Expressed in the epidermis with higher levels in melanocytes compared with keratinocytes and Langerhans cells (at protein level) (PubMe

Sequence

MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYP
VWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNC
RNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTL
GQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFV
TMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTINYKWSFGDNTGLFVSTNHTVN
HTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNTPGPAGDNPLE
LSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI
PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTS
TLISVPDRDPASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKG
LSVFLNRAKAVFFPGNQEKDPLLKNQEFKGVS

Sequence length

572

Interactions

View interactions

	Reactome
			PTK6 promotes HIF1A stabilization

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Amyloidosis	amyloidosis, primary localized cutaneous, 3	rs770211260, rs763065333, rs1554300664, rs747723062, rs773435101, rs140352180	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Endometriosis	Endometriosis	N/A	N/A	GWAS
Parkinson Disease	Parkinson's disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (74)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	23158542
Adenoma	Stimulate	30400781
Adrenoleukodystrophy	Stimulate	35568699
Alzheimer Disease	Stimulate	35568699
Alzheimer Disease	Associate	36504281, 39380021
Amyloidosis	Associate	29336782
Amyotrophic Lateral Sclerosis	Associate	33417599, 35568699
Arthritis Psoriatic	Stimulate	26086874
Birt Hogg Dube Syndrome	Associate	25594584
Bone Demineralization Pathologic	Associate	19833906
Breast Neoplasms	Inhibit	17845721
Breast Neoplasms	Associate	26077887, 30992322, 36061142
Breast Neoplasms	Stimulate	37067377
Carcinogenesis	Associate	17845721, 27334625
Carcinogenesis	Stimulate	30484490
Carcinoma Renal Cell	Associate	37095531
Colonic Diseases	Associate	30400781
Colorectal Neoplasms	Associate	19750230, 24204606, 30400781
Corneal Endothelial Cell Loss	Associate	18447899
Death	Associate	37960806
Diabetes Mellitus Type 1	Associate	32425885
Diabetic Nephropathies	Associate	32425885
Disease	Associate	33417599
Drug Related Side Effects and Adverse Reactions	Associate	34639184
Esophageal Neoplasms	Associate	36090016
Esophageal Squamous Cell Carcinoma	Associate	36862875
Fibrosis	Associate	35280996
Gaucher Disease	Associate	38610104
Glioma	Associate	27334625
Glycogen Storage Disease Type II	Associate	39523364
Head and Neck Neoplasms	Associate	32600105
Hemolytic Uremic Syndrome	Stimulate	19833906
Inflammation	Inhibit	19833906
Inflammation	Associate	29336782, 31315839, 31675496, 34919646
Kidney Diseases	Stimulate	19833906
Kidney Neoplasms	Associate	25594584, 37331486
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	25889792
Lewy Body Disease	Associate	38610104
Lymphatic Metastasis	Stimulate	36090016
Lymphatic Metastasis	Associate	37960806
Melanoma	Associate	16247014, 19383330, 25267741, 26077887
Melanoma	Stimulate	37067377
Multiple Sclerosis	Associate	33417599, 35568699
Muscular Dystrophy Duchenne	Associate	24190443
Myocarditis	Associate	36226312
Neoplasm Invasiveness	Associate	36862875
Neoplasm Metastasis	Associate	26636434, 36061142
Neoplasm Metastasis	Stimulate	28295306, 34108545
Neoplasms	Associate	15967107, 17845721, 18447899, 19383330, 24589892, 26620706, 26636434, 28295306, 28443476, 30760814, 30992322, 32600105, 33242557, 34108545, 34639184 View all (5 more)
Neoplasms	Stimulate	36090016, 37960806
Neurodegenerative Diseases	Associate	35568699
Neuroinflammatory Diseases	Associate	37735116
Neurologic Manifestations	Stimulate	35568699
Osteoarthritis	Associate	20060954
Parkinson Disease	Associate	28391543, 29290481, 33523105, 33726823, 34857772, 35981040, 36504281, 36759259, 36982982
Parkinson Disease	Stimulate	28391543, 35981040
Peripheral Nervous System Diseases	Associate	36671424
Perivascular Epithelioid Cell Neoplasms	Associate	38219952
Pigmentation Disorders	Associate	20056711, 23884103, 29336782
Precancerous Conditions	Associate	30400781
Prostatic Neoplasms	Associate	24589892
Prostatic Neoplasms	Stimulate	37067377
Sarcoma Alveolar Soft Part	Associate	38219952
Scleroderma Systemic	Associate	35280996
Squamous Cell Carcinoma of Head and Neck	Associate	26636434, 28295306, 35365934, 36061142, 37960806
Stomach Neoplasms	Associate	20507635, 26077887, 38631604
Takayasu Arteritis	Associate	31315839
Telfer Sugar Jaeger syndrome	Inhibit	34639184
Tertiary Lymphoid Structures	Associate	32600105
Triple Negative Breast Neoplasms	Stimulate	34108545
Urinary Bladder Neoplasms	Associate	28443476
Uterine Cervical Neoplasms	Stimulate	30484490
Vascular Calcification	Associate	19833906
Vitiligo	Inhibit	32188902, 34639184

GPNMB (glycoprotein nmb)