Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10454
Gene name Gene Name - the full gene name approved by the HGNC.
TGF-beta activated kinase 1 (MAP3K7) binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TAB1
Synonyms (NCBI Gene) Gene synonyms aliases
3'-Tab1, MAP3K7IP1
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein inter
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT047792 hsa-miR-30d-5p CLASH 23622248
MIRT054555 hsa-miR-26b-5p Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot 24565101
MIRT054555 hsa-miR-26b-5p Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot 24565101
MIRT652878 hsa-miR-483-3p HITS-CLIP 23824327
MIRT652878 hsa-miR-483-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0003007 Process Heart morphogenesis IEA
GO:0003279 Process Cardiac septum development IEA
GO:0004722 Function Protein serine/threonine phosphatase activity IBA
GO:0004722 Function Protein serine/threonine phosphatase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602615 18157 ENSG00000100324
Protein
UniProt ID Q15750
Protein name TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 1) (TGF-beta-activated kinase 1-binding protein 1) (TAK1-binding protein 1)
Protein function Key adapter protein that plays an essential role in JNK and NF-kappa-B activation and proinflammatory cytokines production in response to stimulation with TLRs and cytokines (PubMed:22307082, PubMed:24403530). Mechanistically, associates with th
PDB 2J4O , 2POM , 2POP , 2YDS , 2YIY , 4AY5 , 4AY6 , 4GS6 , 4KA3 , 4L3P , 4L52 , 4L53 , 4O91 , 5DIY , 5E7R , 5GJD , 5GJF , 5GJG , 5J7S , 5J8I , 5J9L , 5JGA , 5JGB , 5JGD , 5JH6 , 5JK3 , 5NZZ , 5O90 , 5V5N , 5VVU , 7NTH , 7NTI , 8GW3 , 8XI8 , 9FPD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00481 PP2C 69 334 Protein phosphatase 2C Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12429732}.
Sequence
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRV
KRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP
Sequence length 504
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Alcoholic liver disease
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Yersinia infection
Leishmaniasis
Toxoplasmosis
Hepatitis B
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Lipid and atherosclerosis
  NOD1/2 Signaling Pathway
FCERI mediated NF-kB activation
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
activated TAK1 mediates p38 MAPK activation
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
TNFR1-induced NFkappaB signaling pathway
CLEC7A (Dectin-1) signaling
Ub-specific processing proteases
TICAM1,TRAF6-dependent induction of TAK1 complex
Interleukin-1 signaling
IRAK2 mediated activation of TAK1 complex
TRAF6-mediated induction of TAK1 complex within TLR4 complex
Alpha-protein kinase 1 signaling pathway
IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Visfatin levels in type 2 diabetes N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Non Small Cell Lung Associate 26884850
Cardiomyopathies Associate 12488458
Colorectal Neoplasms Associate 29328486
Coronary Artery Disease Associate 39445733
COVID 19 Associate 34536086
Death Associate 23934659
Diabetes Mellitus Type 2 Associate 33902539
Disease Associate 34536086
Esophageal Squamous Cell Carcinoma Associate 36609391
Hypercholesterolemia Associate 39445733