Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10452
Gene name Gene Name - the full gene name approved by the HGNC.	Translocase of outer mitochondrial membrane 40
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TOMM40
Synonyms (NCBI Gene) Gene synonyms aliases	C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is localized in the outer membrane of the mitochondria. It is the channel-forming subunit of the translocase of the mitochondrial outer membrane (TOM) complex that is essential for import of protein precursors into mitocho

Show/Hide all(130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025243	hsa-miR-34a-5p	Proteomics	21566225
MIRT025243	hsa-miR-34a-5p	Proteomics	21566225
MIRT025243	hsa-miR-34a-5p	Proteomics	21566225
MIRT025243	hsa-miR-34a-5p	Proteomics	21566225
MIRT042816	hsa-miR-324-3p	CLASH	23622248
MIRT042204	hsa-miR-484	CLASH	23622248
MIRT040094	hsa-miR-615-3p	CLASH	23622248
MIRT640238	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT640237	hsa-miR-8073	HITS-CLIP	23824327
MIRT640236	hsa-miR-1306-3p	HITS-CLIP	23824327
MIRT640235	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT640234	hsa-miR-5695	HITS-CLIP	23824327
MIRT640233	hsa-miR-3176	HITS-CLIP	23824327
MIRT640232	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT640231	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT640230	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT640229	hsa-miR-6131	HITS-CLIP	23824327
MIRT640228	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT640227	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT640226	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT640225	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT640224	hsa-miR-548s	HITS-CLIP	23824327
MIRT640223	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT640222	hsa-miR-588	HITS-CLIP	23824327
MIRT640221	hsa-miR-4435	HITS-CLIP	23824327
MIRT640220	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT640219	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT640218	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT640217	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT568688	hsa-miR-4453	PAR-CLIP	20371350
MIRT568687	hsa-miR-4538	PAR-CLIP	20371350
MIRT568686	hsa-miR-1245b-3p	PAR-CLIP	20371350
MIRT568685	hsa-miR-3136-3p	PAR-CLIP	20371350
MIRT568684	hsa-miR-7155-3p	PAR-CLIP	20371350
MIRT568683	hsa-miR-328-3p	PAR-CLIP	20371350
MIRT568688	hsa-miR-4453	PAR-CLIP	20371350
MIRT568687	hsa-miR-4538	PAR-CLIP	20371350
MIRT568686	hsa-miR-1245b-3p	PAR-CLIP	20371350
MIRT568685	hsa-miR-3136-3p	PAR-CLIP	20371350
MIRT568684	hsa-miR-7155-3p	PAR-CLIP	20371350
MIRT568683	hsa-miR-328-3p	PAR-CLIP	20371350
MIRT640238	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT640237	hsa-miR-8073	HITS-CLIP	23824327
MIRT640236	hsa-miR-1306-3p	HITS-CLIP	23824327
MIRT640235	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT640234	hsa-miR-5695	HITS-CLIP	23824327
MIRT640233	hsa-miR-3176	HITS-CLIP	23824327
MIRT640232	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT640231	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT640230	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT640229	hsa-miR-6131	HITS-CLIP	23824327
MIRT640228	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT640227	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT640226	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT640225	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT640224	hsa-miR-548s	HITS-CLIP	23824327
MIRT640223	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT640222	hsa-miR-588	HITS-CLIP	23824327
MIRT640221	hsa-miR-4435	HITS-CLIP	23824327
MIRT640220	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT640219	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT640218	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT640217	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT568688	hsa-miR-4453	PAR-CLIP	20371350
MIRT568687	hsa-miR-4538	PAR-CLIP	20371350
MIRT568686	hsa-miR-1245b-3p	PAR-CLIP	20371350
MIRT568685	hsa-miR-3136-3p	PAR-CLIP	20371350
MIRT568684	hsa-miR-7155-3p	PAR-CLIP	20371350
MIRT568683	hsa-miR-328-3p	PAR-CLIP	20371350
MIRT568688	hsa-miR-4453	PAR-CLIP	20371350
MIRT568687	hsa-miR-4538	PAR-CLIP	20371350
MIRT568686	hsa-miR-1245b-3p	PAR-CLIP	20371350
MIRT568685	hsa-miR-3136-3p	PAR-CLIP	20371350
MIRT568684	hsa-miR-7155-3p	PAR-CLIP	20371350
MIRT568683	hsa-miR-328-3p	PAR-CLIP	20371350
MIRT1446688	hsa-miR-1207-5p	CLIP-seq
MIRT1446689	hsa-miR-1909	CLIP-seq
MIRT1446690	hsa-miR-3688-5p	CLIP-seq
MIRT1446691	hsa-miR-3689d	CLIP-seq
MIRT1446692	hsa-miR-4716-3p	CLIP-seq
MIRT1446693	hsa-miR-4723-5p	CLIP-seq
MIRT1446694	hsa-miR-4736	CLIP-seq
MIRT1446695	hsa-miR-4763-3p	CLIP-seq
MIRT1446688	hsa-miR-1207-5p	CLIP-seq
MIRT1446689	hsa-miR-1909	CLIP-seq
MIRT1446696	hsa-miR-24	CLIP-seq
MIRT1446690	hsa-miR-3688-5p	CLIP-seq
MIRT1446691	hsa-miR-3689d	CLIP-seq
MIRT1446697	hsa-miR-4283	CLIP-seq
MIRT1446692	hsa-miR-4716-3p	CLIP-seq
MIRT1446693	hsa-miR-4723-5p	CLIP-seq
MIRT1446694	hsa-miR-4736	CLIP-seq
MIRT1446695	hsa-miR-4763-3p	CLIP-seq
MIRT1555124	hsa-miR-4728-5p	CLIP-seq
MIRT2133582	hsa-miR-129-5p	CLIP-seq
MIRT2133583	hsa-miR-3662	CLIP-seq
MIRT2133582	hsa-miR-129-5p	CLIP-seq
MIRT2133584	hsa-miR-340	CLIP-seq
MIRT2133585	hsa-miR-3607-3p	CLIP-seq
MIRT2133583	hsa-miR-3662	CLIP-seq
MIRT2133586	hsa-miR-3686	CLIP-seq
MIRT1446691	hsa-miR-3689d	CLIP-seq
MIRT2133587	hsa-miR-4449	CLIP-seq
MIRT2133588	hsa-miR-4652-3p	CLIP-seq
MIRT2133589	hsa-miR-4783-3p	CLIP-seq
MIRT2133590	hsa-miR-587	CLIP-seq
MIRT2133591	hsa-miR-671-3p	CLIP-seq
MIRT2648547	hsa-miR-1913	CLIP-seq
MIRT2648548	hsa-miR-2110	CLIP-seq
MIRT2648549	hsa-miR-2392	CLIP-seq
MIRT2648550	hsa-miR-3144-5p	CLIP-seq
MIRT2648551	hsa-miR-3180	CLIP-seq
MIRT2648552	hsa-miR-3180-3p	CLIP-seq
MIRT2648553	hsa-miR-3183	CLIP-seq
MIRT2648554	hsa-miR-3191	CLIP-seq
MIRT2648555	hsa-miR-3196	CLIP-seq
MIRT2648556	hsa-miR-3605-5p	CLIP-seq
MIRT2648557	hsa-miR-4268	CLIP-seq
MIRT2648558	hsa-miR-4271	CLIP-seq
MIRT2648559	hsa-miR-4313	CLIP-seq
MIRT2648560	hsa-miR-4443	CLIP-seq
MIRT2648561	hsa-miR-4508	CLIP-seq
MIRT2648562	hsa-miR-4652-5p	CLIP-seq
MIRT2648563	hsa-miR-4655-5p	CLIP-seq
MIRT2648564	hsa-miR-4723-3p	CLIP-seq
MIRT2648565	hsa-miR-4725-3p	CLIP-seq
MIRT2648566	hsa-miR-542-5p	CLIP-seq
MIRT2648567	hsa-miR-639	CLIP-seq
MIRT2648568	hsa-miR-720	CLIP-seq
MIRT2648569	hsa-miR-765	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	27554484, 31206022, 31412244
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IMP	11745481
GO:0005741	Component	Mitochondrial outer membrane	ISS	10980201
GO:0005741	Component	Mitochondrial outer membrane	NAS	18331822
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005742	Component	Mitochondrial outer membrane translocase complex	IBA
GO:0005742	Component	Mitochondrial outer membrane translocase complex	IDA	12198123, 15644312
GO:0005743	Component	Mitochondrial inner membrane	IDA	24746669
GO:0005829	Component	Cytosol	IDA
GO:0006626	Process	Protein targeting to mitochondrion	IGI	31206022
GO:0006626	Process	Protein targeting to mitochondrion	ISS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008320	Function	Protein transmembrane transporter activity	IBA
GO:0008320	Function	Protein transmembrane transporter activity	IEA
GO:0008320	Function	Protein transmembrane transporter activity	ISS
GO:0008320	Function	Protein transmembrane transporter activity	TAS	15644312
GO:0015031	Process	Protein transport	IEA
GO:0015288	Function	Porin activity	IEA
GO:0016020	Component	Membrane	IDA	15644312
GO:0016020	Component	Membrane	IEA
GO:0030150	Process	Protein import into mitochondrial matrix	IBA
GO:0030150	Process	Protein import into mitochondrial matrix	IEA
GO:0030150	Process	Protein import into mitochondrial matrix	IMP	15644312
GO:0044233	Component	Mitochondria-associated endoplasmic reticulum membrane contact site	IDA	31206022
GO:0045040	Process	Protein insertion into mitochondrial outer membrane	NAS	18331822
GO:0046930	Component	Pore complex	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0140596	Component	TOM complex	NAS	18331822

MIM	HGNC	e!Ensembl
608061	18001	ENSG00000130204

Protein

UniProt ID

O96008

Protein name

Mitochondrial import receptor subunit TOM40 homolog (Protein Haymaker) (Translocase of outer membrane 40 kDa subunit homolog) (p38.5)

Protein function

Channel-forming protein essential for import of protein precursors into mitochondria (PubMed:15644312, PubMed:31206022). Plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a com

PDB

7CK6 , 7CP9 , 7VBY , 7VC4 , 7VD2 , 7VDD , 8XVA , 9EIH , 9EII , 9EIJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01459	Porin_3	79 → 355	Eukaryotic porin	Family

Sequence

MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G

Sequence length

361

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal Amyotrophic lateral sclerosis Pathways of neurodegeneration - multiple diseases		Pink/Parkin Mediated Mitophagy

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Hyperlipidemia	Hyperlipidemia	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (53)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	22911757
Alzheimer Disease	Associate	16943564, 17434289, 19442637, 19554612, 19734902, 20029386, 20298972, 20885792, 21123754, 21379329, 21455713, 21459483, 21784354, 21803501, 21820212 View all (73 more)
Alzheimer Disease	Stimulate	19668339, 34204109
Alzheimer Disease	Inhibit	30462377
Arthritis Rheumatoid	Associate	36524113
Ataxia Telangiectasia	Associate	24439168
Atrophy	Associate	26993346, 31760383
Calcinosis Cutis	Associate	38285218
Carcinoma Non Small Cell Lung	Associate	36408734
Cardiomyopathy Dilated	Inhibit	33303703
Carotid Artery Diseases	Associate	19951432
Cerebral Palsy	Associate	24786335, 25703783
Cognition Disorders	Associate	23102119, 25703783, 26742953, 26873889, 28108637, 28624335, 31201950, 31760383, 33580752, 35499926, 37718796
Cognitive Dysfunction	Associate	22911757, 23102119, 26444770, 28549947
Coronary Artery Disease	Associate	28686695, 39201500
Coronary Disease	Associate	27707806
Coronary Restenosis	Associate	36450556
Dementia	Associate	26756745, 29739406, 30706571, 33300824, 37718796
Depressive Disorder	Associate	22863908, 24549102
Depressive Disorder Major	Associate	24549102
Diabetes Mellitus	Associate	25044051
Diabetes Mellitus Type 2	Associate	25044051, 26252223, 27189021
Diffuse Neurofibrillary Tangles with Calcification	Associate	32472747
Drug Related Side Effects and Adverse Reactions	Associate	9151698
Dyslipidemias	Associate	29670124
Epilepsy	Associate	24786335, 25703783
Heart Diseases	Associate	24549102
Huntington Disease	Associate	21257639
Hyperlipoproteinemia Type II	Associate	32727492
Inflammation	Associate	31318836, 36835494
Lewy Body Disease	Associate	26756745
Liver Cirrhosis	Associate	33856023
Lupus Erythematosus Systemic	Associate	36524113
Memory Disorders	Associate	26873889
Metabolic Syndrome	Associate	38201907
Mitochondrial Diseases	Associate	28183529, 30517207, 34204109, 36835494, 37895139
Multiple Trauma	Associate	31318836
Myocardial Infarction	Associate	32727492
Myositis Inclusion Body	Associate	25670332
Neoplasms	Associate	9151698
Neurodegenerative Diseases	Inhibit	35951602
Neuroinflammatory Diseases	Associate	36835494
Neurotoxicity Syndromes	Associate	36835494
Osteosarcoma	Associate	38285218
Parkinson Disease	Associate	24149440, 26756745
Parkinson Disease	Inhibit	35951602
Parkinson Disease Secondary	Associate	26756745
Psychotic Disorders	Associate	21820212
Renal Insufficiency Chronic	Associate	25311932
Reticular dysgenesis	Associate	35136347
Tremor	Associate	25703783
Vascular Diseases	Associate	24508314
Wounds Nonpenetrating	Associate	31318836

TOMM40 (translocase of outer mitochondrial membrane 40)