PRMT5 (protein arginine methyltransferase 5)

Gene

• Entrez ID: 10419
• Gene name: Protein arginine methyltransferase 5
• Gene symbol: PRMT5
• Synonyms (NCBI Gene): HRMT1L5, HSL7, IBP72, JBP1, SKB1, SKB1Hs
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor su

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004350	hsa-miR-19a-3p	Western blot	18694959
MIRT000983	hsa-miR-25-3p	Western blot	18694959
MIRT000982	hsa-miR-32-5p	Western blot	18694959
MIRT004351	hsa-miR-92b-3p	Western blot	18694959
MIRT004352	hsa-miR-96-5p	Western blot	18694959
MIRT004350	hsa-miR-19a-3p	Western blot	18694959
MIRT000983	hsa-miR-25-3p	Western blot	18694959
MIRT000982	hsa-miR-32-5p	Western blot	18694959
MIRT044499	hsa-miR-320a	CLASH	23622248
MIRT042720	hsa-miR-346	CLASH	23622248
MIRT004352	hsa-miR-96-5p	Microarray, qRT-PCR	35816043
MIRT1264628	hsa-miR-188-5p	CLIP-seq
MIRT1264629	hsa-miR-374a	CLIP-seq
MIRT1264630	hsa-miR-374b	CLIP-seq
MIRT1264631	hsa-miR-4780	CLIP-seq
MIRT1264632	hsa-miR-623	CLIP-seq
MIRT1264633	hsa-miR-944	CLIP-seq
MIRT1264634	hsa-miR-1237	CLIP-seq
MIRT1264635	hsa-miR-217	CLIP-seq
MIRT1264636	hsa-miR-3130-3p	CLIP-seq
MIRT1264637	hsa-miR-3182	CLIP-seq
MIRT1264638	hsa-miR-3647-3p	CLIP-seq
MIRT1264639	hsa-miR-3686	CLIP-seq
MIRT1264640	hsa-miR-3929	CLIP-seq
MIRT1264641	hsa-miR-4418	CLIP-seq
MIRT1264642	hsa-miR-4419b	CLIP-seq
MIRT1264643	hsa-miR-4478	CLIP-seq
MIRT1264644	hsa-miR-4668-3p	CLIP-seq
MIRT1264645	hsa-miR-4773	CLIP-seq
MIRT1264646	hsa-miR-509-3-5p	CLIP-seq
MIRT1264647	hsa-miR-509-5p	CLIP-seq
MIRT1264648	hsa-miR-576-3p	CLIP-seq
MIRT2457201	hsa-miR-127-5p	CLIP-seq
MIRT2457202	hsa-miR-4468	CLIP-seq
MIRT2457203	hsa-miR-4700-3p	CLIP-seq
MIRT2601223	hsa-miR-1266	CLIP-seq
MIRT2601224	hsa-miR-1304	CLIP-seq
MIRT2601225	hsa-miR-1323	CLIP-seq
MIRT2601226	hsa-miR-2117	CLIP-seq
MIRT2601227	hsa-miR-2467-5p	CLIP-seq
MIRT2601228	hsa-miR-3188	CLIP-seq
MIRT2601229	hsa-miR-338-3p	CLIP-seq
MIRT1264638	hsa-miR-3647-3p	CLIP-seq
MIRT2601230	hsa-miR-3664-3p	CLIP-seq
MIRT2601231	hsa-miR-3671	CLIP-seq
MIRT1264640	hsa-miR-3929	CLIP-seq
MIRT2601232	hsa-miR-3941	CLIP-seq
MIRT2601233	hsa-miR-3975	CLIP-seq
MIRT2601234	hsa-miR-4270	CLIP-seq
MIRT2601235	hsa-miR-4273	CLIP-seq
MIRT1264642	hsa-miR-4419b	CLIP-seq
MIRT2601236	hsa-miR-4441	CLIP-seq
MIRT1264643	hsa-miR-4478	CLIP-seq
MIRT2601237	hsa-miR-4518	CLIP-seq
MIRT2601238	hsa-miR-4530	CLIP-seq
MIRT2601239	hsa-miR-466	CLIP-seq
MIRT1264644	hsa-miR-4668-3p	CLIP-seq
MIRT2601240	hsa-miR-4672	CLIP-seq
MIRT2601241	hsa-miR-4685-5p	CLIP-seq
MIRT2601242	hsa-miR-4716-5p	CLIP-seq
MIRT2601243	hsa-miR-4731-3p	CLIP-seq
MIRT2601244	hsa-miR-4762-5p	CLIP-seq
MIRT1264645	hsa-miR-4773	CLIP-seq
MIRT2601245	hsa-miR-4801	CLIP-seq
MIRT2601246	hsa-miR-485-5p	CLIP-seq
MIRT2601247	hsa-miR-526b	CLIP-seq
MIRT2601248	hsa-miR-548aa	CLIP-seq
MIRT2601249	hsa-miR-548o	CLIP-seq
MIRT2601250	hsa-miR-607	CLIP-seq
MIRT2601223	hsa-miR-1266	CLIP-seq
MIRT2601224	hsa-miR-1304	CLIP-seq
MIRT2601225	hsa-miR-1323	CLIP-seq
MIRT2601226	hsa-miR-2117	CLIP-seq
MIRT2601227	hsa-miR-2467-5p	CLIP-seq
MIRT2601228	hsa-miR-3188	CLIP-seq
MIRT2601229	hsa-miR-338-3p	CLIP-seq
MIRT1264638	hsa-miR-3647-3p	CLIP-seq
MIRT2601230	hsa-miR-3664-3p	CLIP-seq
MIRT2601231	hsa-miR-3671	CLIP-seq
MIRT1264640	hsa-miR-3929	CLIP-seq
MIRT2601232	hsa-miR-3941	CLIP-seq
MIRT2601233	hsa-miR-3975	CLIP-seq
MIRT2601234	hsa-miR-4270	CLIP-seq
MIRT2601235	hsa-miR-4273	CLIP-seq
MIRT1264642	hsa-miR-4419b	CLIP-seq
MIRT2601236	hsa-miR-4441	CLIP-seq
MIRT1264643	hsa-miR-4478	CLIP-seq
MIRT2601237	hsa-miR-4518	CLIP-seq
MIRT2601238	hsa-miR-4530	CLIP-seq
MIRT2601239	hsa-miR-466	CLIP-seq
MIRT1264644	hsa-miR-4668-3p	CLIP-seq
MIRT2601240	hsa-miR-4672	CLIP-seq
MIRT2601241	hsa-miR-4685-5p	CLIP-seq
MIRT2601242	hsa-miR-4716-5p	CLIP-seq
MIRT2601243	hsa-miR-4731-3p	CLIP-seq
MIRT2601244	hsa-miR-4762-5p	CLIP-seq
MIRT1264645	hsa-miR-4773	CLIP-seq
MIRT2601245	hsa-miR-4801	CLIP-seq
MIRT2601246	hsa-miR-485-5p	CLIP-seq
MIRT2601247	hsa-miR-526b	CLIP-seq
MIRT2601248	hsa-miR-548aa	CLIP-seq
MIRT2601249	hsa-miR-548o	CLIP-seq
MIRT2601250	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000387	Process	Spliceosomal snRNP assembly	IMP	17709427
GO:0000387	Process	Spliceosomal snRNP assembly	NAS	11756452
GO:0000785	Component	Chromatin	IDA	33376131
GO:0002039	Function	P53 binding	IPI	19011621
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0005515	Function	Protein binding	IPI	11756452, 12577067, 16087681, 18404153, 18984161, 19011621, 19234465, 20133701, 20159986, 20421892, 20810653, 20951943, 21081503, 22269951, 22327218, 22365833, 23071334, 23133559, 23455924, 23892143, 25092918, 25284789, 25852190, 26700805, 26763441, 26912361, 32296183, 32707033, 328
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21081503
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	18404153
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	22952863
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	20421892
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	18984161, 21081503
GO:0005829	Component	Cytosol	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	18404153
GO:0006353	Process	DNA-templated transcription termination	IMP	26700805
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0007088	Process	Regulation of mitotic nuclear division	TAS	9843966
GO:0008168	Function	Methyltransferase activity	IDA	15369763, 19011621
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008327	Function	Methyl-CpG binding	IDA	25284789
GO:0008469	Function	Histone arginine N-methyltransferase activity	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IDA	20421892, 26554819
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018216	Process	Peptidyl-arginine methylation	IMP	17709427
GO:0032259	Process	Methylation	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0034709	Component	Methylosome	IDA	11756452, 18984161, 25284789
GO:0035097	Component	Histone methyltransferase complex	IDA	23048031
GO:0035097	Component	Histone methyltransferase complex	IEA
GO:0035243	Function	Protein-arginine omega-N symmetric methyltransferase activity	EXP	19011621
GO:0035243	Function	Protein-arginine omega-N symmetric methyltransferase activity	IDA	22143770
GO:0035243	Function	Protein-arginine omega-N symmetric methyltransferase activity	IEA
GO:0035243	Function	Protein-arginine omega-N symmetric methyltransferase activity	IMP	17709427
GO:0035246	Process	Peptidyl-arginine N-methylation	IDA	15369763
GO:0042054	Function	Histone methyltransferase activity	TAS
GO:0042118	Process	Endothelial cell activation	IMP	22269951
GO:0042802	Function	Identical protein binding	IPI	11756452, 22365833, 23071334
GO:0043021	Function	Ribonucleoprotein complex binding	IPI	17709427
GO:0044020	Function	Histone H4R3 methyltransferase activity	IDA	18404153, 22143770
GO:0044020	Function	Histone H4R3 methyltransferase activity	IEA
GO:0044020	Function	Histone H4R3 methyltransferase activity	IMP	25284789
GO:0044020	Function	Histone H4R3 methyltransferase activity	ISS
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	18495660
GO:0048026	Process	Positive regulation of mRNA splicing, via spliceosome	NAS	11756452
GO:0048511	Process	Rhythmic process	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IEA
GO:0070888	Function	E-box binding	ISS
GO:0090161	Process	Golgi ribbon formation	IMP	20421892
GO:0097421	Process	Liver regeneration	IEA
GO:0140938	Function	Histone H3 methyltransferase activity	TAS
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1904992	Process	Positive regulation of adenylate cyclase-inhibiting dopamine receptor signaling pathway	IGI	26554819

Other IDs

• MIM: 604045
• HGNC: 10894
• e!Ensembl: ENSG00000100462

Protein

• UniProt ID: O14744
• Protein name: Protein arginine N-methyltransferase 5 (PRMT5) (EC 2.1.1.320) (72 kDa ICln-binding protein) (Histone-arginine N-methyltransferase PRMT5) (Jak-binding protein 1) (Shk1 kinase-binding protein 1 homolog) (SKB1 homolog) (SKB1Hs) [Cleaved into: Protein arginin
• Protein function: Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA (PubMed:10531356, PubMed:11152681, PubMed:11747828, PubMed:12
• PDB: 4GQB, 4X60, 4X61, 4X63, 5C9Z, 5EMJ, 5EMK, 5EML, 5EMM, 5FA5, 6CKC, 6K1S, 6RLL, 6RLQ, 6UGH, 6UXX, 6UXY, 6V0N, 6V0O, 6V0P, 7BO7, 7BOC, 7KIB, 7KIC, 7KID, 7L1G, 7M05, 7MX7, 7MXA, 7MXC, 7MXG, 7MXN, 7S0U, 7S1P, 7S1Q, 7S1R, 7S1S, 7SER, 7SES, 7U30, 7UOH, 7UY1, 7UYF, 7ZUP, 7ZUQ, 7ZUU, 7ZUY, 7ZV2, 7ZVL, 7ZVU, 8CSG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17285	PRMT5_TIM	37 → 290	PRMT5 TIM barrel domain	Domain
  PF05185	PRMT5	295 → 464	PRMT5 arginine-N-methyltransferase	Domain
  PF17286	PRMT5_C	467 → 635	PRMT5 oligomerisation domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9556550}.
• Sequence:

  MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
  NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
  AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
  GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
  KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
  AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
  LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
  REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
  YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
  PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
  RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

• Sequence length: 637

Pathways

Reactome:

snRNP Assembly
RMTs methylate histone arginines
Regulation of TP53 Activity through Methylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Associate	24775604	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma in Situ	Associate	24775604	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	24775604, 27270440, 34200178	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	33788842	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	27860244	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Associate	28669403	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	21700716, 25704480, 26420673, 27270440, 28381188, 28977470, 30289978, 33462997, 33782401, 36913304, 37400460, 37458145	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	36161608	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	24326178, 25475372, 34200178, 36878903	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Associate	24326178	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Inhibit	18992153	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Associate	33416213	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	28074910, 28101581, 36114756, 36232624, 36499164	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	24326178, 35149174, 35747993, 36364261	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	23292799	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	35979371, 37781030	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	27270440	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Associate	35126952	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Associate	33788842	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	33788842	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Stimulate	32887644	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	32456215, 32985589, 40302325	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	40269778	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	30704408	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	32121248	★☆☆☆☆ Found in Text Mining only
Death	Associate	28107179	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	19372584	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	33090401	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	36764215	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	36499164	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	24664369, 26563484, 31533041, 31685892, 31694585	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	24664369, 29529599, 38172189	★☆☆☆☆ Found in Text Mining only
HAIR AN syndrome	Stimulate	36499164	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	37178682	★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Associate	28669403, 30257864	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	26420673, 37861290	★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	37400960	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	38252663	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	27860244, 37399609	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	18694959, 28874563, 30184499, 34712735, 35305370, 37148657	★☆☆☆☆ Found in Text Mining only
Leukemia B Cell	Associate	31123343	★☆☆☆☆ Found in Text Mining only
Leukemia Erythroblastic Acute	Associate	30257864	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	18694959, 32555249	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Stimulate	26729154	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Stimulate	26729154	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	31765670	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	30184499, 34712735, 35305370, 40057764	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	24326178, 30736843, 34200178, 35149174, 35766227, 36927233	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	30461193, 31665911, 37400960	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	33090401, 35434944, 36161608, 36927233	★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	18694959, 28874563, 30184499, 31822509, 36167829	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	31822509, 36167829	★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	31123343, 31822509	★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	17627275	★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Stimulate	31822509	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Associate	31694585	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Associate	24850177, 29227283, 31439820, 37917641	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Associate	33795785	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Associate	21316606	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Inhibit	30704408	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	27270440, 31378882, 35803962, 36927233, 37400960	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	33090401	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	17627275, 18694959, 27270440, 30184499, 32872669	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19372584, 21700716, 23292799, 24326178, 24664369, 24764298, 24775604, 25220593, 25281873, 26373535, 26912360, 28381188, 28874563, 28977470, 30257864, 30282801, 30289978, 30461193, 31123343, 31257072, 31533041, 31665911, 31765670, 31822509, 32456215, 32709847, 33416213, 33462997, 33782401, 33795785, 34518040, 35305370, 35803962, 36114756, 36199122, 36232624, 36364261, 36499164, 36913304, 37047013, 37380368, 37400460, 37400960, 37552839, 37861290, 37887269, 38118413, 38583010, 38640748, 39874873	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	28074910, 28107179	★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Stimulate	23292799	★☆☆☆☆ Found in Text Mining only
Neoplasms Germ Cell and Embryonal	Associate	18992153	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	25475372, 35803962, 38049564	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	24326178	★☆☆☆☆ Found in Text Mining only
No Reflow Phenomenon	Associate	33788842	★☆☆☆☆ Found in Text Mining only
Nonseminomatous germ cell tumor	Inhibit	18992153	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Stimulate	32887644	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	32023548	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	23292799	★☆☆☆☆ Found in Text Mining only
Peritonitis	Associate	27315569	★☆☆☆☆ Found in Text Mining only
Personality Disorders	Associate	35624451	★☆☆☆☆ Found in Text Mining only
Polypoidal Choroidal Vasculopathy	Associate	37887269	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	25281873, 31378882, 35624451, 38583010	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Associate	36041632	★☆☆☆☆ Found in Text Mining only
Seminoma	Associate	18992153	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	36927233	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	28107179, 36878903, 37887269	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	27315569, 31701767, 32292506	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	37380368	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Associate	35434944, 36199122	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	37399609	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Associate	37399609	★☆☆☆☆ Found in Text Mining only