Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	10403
Gene name	NDC80 kinetochore complex component
Gene symbol	NDC80
Synonyms (NCBI Gene)	HECHEC1HsHec1KNTC2TID3hsNDC80
Chromosome	18
Chromosome location	18p11.32
Summary	This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to o

Show/Hide all (5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016353	hsa-miR-193b-3p	Microarray	20304954
MIRT1177859	hsa-miR-1246	CLIP-seq
MIRT1177860	hsa-miR-3201	CLIP-seq
MIRT1177861	hsa-miR-4791	CLIP-seq
MIRT1177862	hsa-miR-590-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ATF4	Activation	17822787
CREB1	Activation	17822787

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	TAS	9315664
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	19468067
GO:0000278	Process	Mitotic cell cycle	TAS	9315664
GO:0000280	Process	Nuclear division	IEA
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000775	Component	Chromosome, centromeric region	TAS	9315664
GO:0000776	Component	Kinetochore	IDA	14699129, 15961401, 17363900, 19468067
GO:0000776	Component	Kinetochore	IEA
GO:0000776	Component	Kinetochore	NAS	23418356
GO:0000940	Component	Outer kinetochore	IDA	18195732, 24530301
GO:0005515	Function	Protein binding	IPI	14699129, 15713649, 15824131, 15961401, 16189514, 16732327, 17129783, 20360068, 22581055, 24981860, 25281560, 25416956, 26068854, 26496610, 28514442, 29892012, 30886144, 31515488, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9315664
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007051	Process	Spindle organization	IEA
GO:0007052	Process	Mitotic spindle organization	IMP	14699129
GO:0007057	Process	Spindle assembly involved in female meiosis I	IEA
GO:0007059	Process	Chromosome segregation	IMP	14699129
GO:0007059	Process	Chromosome segregation	NAS	18455984
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	NAS	18455984
GO:0008017	Function	Microtubule binding	IMP	18455984
GO:0008315	Process	G2/MI transition of meiotic cell cycle	IEA
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	IDA	18455984
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	IMP	19468067
GO:0014841	Process	Skeletal muscle satellite cell proliferation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016607	Component	Nuclear speck	IDA
GO:0030332	Function	Cyclin binding	IEA
GO:0031262	Component	Ndc80 complex	IBA
GO:0031262	Component	Ndc80 complex	IDA	14699129, 20819937
GO:0031262	Component	Ndc80 complex	IEA
GO:0031262	Component	Ndc80 complex	IPI	18455984
GO:0031647	Process	Regulation of protein stability	IEA
GO:0042802	Function	Identical protein binding	IPI	20360068, 25416956
GO:0051276	Process	Chromosome organization	IEA
GO:0051298	Process	Centrosome duplication	IDA	18940925
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase chromosome alignment	IDA	18940925
GO:0051310	Process	Metaphase chromosome alignment	IMP	25743205
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IBA
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	30409912
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IEA
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	22581055, 23891108, 25743205
GO:0051383	Process	Kinetochore organization	IEA
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	25743205
GO:0098813	Process	Nuclear chromosome segregation	IEA
GO:0140483	Function	Kinetochore adaptor activity	IDA	30409912

MIM	HGNC	e!Ensembl
607272	16909	ENSG00000080986

O14777

Protein name

Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC)

Protein function

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:12351790, PubMed:14654001, PubMed:14699129, PubMed:15062103, PubMed:15235793, PubMed:

PDB

2IGP , 2VE7 , 3IZ0 , 8G0P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03801	Ndc80_HEC	51 → 206	HEC/Ndc80p family	Family
PF18077	DUF5595	213 → 285	Domain of unknown function (DUF5595)	Domain

Sequence

MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKR
TSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAP
SVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPH
IVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGA
DSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLK
ASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQK
YSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKM
GLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKH
LLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHL
EEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE

Sequence length

642

Interactions

View interactions

	KEGG		Reactome
	Cell cycle		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

NDC80 (NDC80 kinetochore complex component)