Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10403
Gene name Gene Name - the full gene name approved by the HGNC.	NDC80 kinetochore complex component
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NDC80
Synonyms (NCBI Gene) Gene synonyms aliases	HEC, HEC1, HsHec1, KNTC2, TID3, hsNDC80
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18p11.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to o

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016353	hsa-miR-193b-3p	Microarray	20304954
MIRT1177859	hsa-miR-1246	CLIP-seq
MIRT1177860	hsa-miR-3201	CLIP-seq
MIRT1177861	hsa-miR-4791	CLIP-seq
MIRT1177862	hsa-miR-590-3p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ATF4	Activation	17822787
CREB1	Activation	17822787

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	TAS	9315664
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	19468067
GO:0000278	Process	Mitotic cell cycle	TAS	9315664
GO:0000775	Component	Chromosome, centromeric region	TAS	9315664
GO:0000776	Component	Kinetochore	IDA	17363900, 19468067
GO:0000777	Component	Condensed chromosome kinetochore	IDA	14699129
GO:0000778	Component	Condensed nuclear chromosome kinetochore	IBA	21873635
GO:0000942	Component	Condensed nuclear chromosome outer kinetochore	IDA	18195732
GO:0005515	Function	Protein binding	IPI	14699129, 15713649, 15824131, 15961401, 16189514, 16732327, 17129783, 20360068, 22581055, 24981860, 25416956, 26068854, 26496610, 28514442, 29892012, 30886144, 31515488, 32296183
GO:0005634	Component	Nucleus	TAS	9315664
GO:0005654	Component	Nucleoplasm	IDA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007052	Process	Mitotic spindle organization	IMP	14699129
GO:0007059	Process	Chromosome segregation	IMP	14699129
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	IMP	19468067
GO:0016020	Component	Membrane	HDA	19946888
GO:0031262	Component	Ndc80 complex	IBA	21873635
GO:0031262	Component	Ndc80 complex	IDA	14699129
GO:0042802	Function	Identical protein binding	IPI	20360068, 25416956
GO:0051298	Process	Centrosome duplication	IDA	18940925
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase plate congression	IDA	18940925
GO:0051310	Process	Metaphase plate congression	IMP	25743205
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IBA	21873635
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	23891108, 25743205
GO:0051383	Process	Kinetochore organization	IMP	22581055
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	25743205
GO:1905342	Process	Positive regulation of protein localization to kinetochore	IMP	22581055

MIM	HGNC	e!Ensembl
607272	16909	ENSG00000080986

Protein

UniProt ID

O14777

Protein name

Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC)

Protein function

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:12351790, PubMed:14654001, PubMed:14699129, PubMed:15062103, PubMed:15235793, PubMed:

PDB

2IGP , 2VE7 , 3IZ0 , 8G0P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03801	Ndc80_HEC	51 → 206	HEC/Ndc80p family	Family
PF18077	DUF5595	213 → 285	Domain of unknown function (DUF5595)	Domain

Sequence

MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKR
TSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAP
SVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPH
IVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGA
DSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLK
ASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQK
YSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKM
GLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKH
LLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHL
EEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE

Sequence length

642

Interactions

View interactions

	KEGG		Reactome
	Cell cycle		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

NDC80 (NDC80 kinetochore complex component)