Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10402
Gene name	ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Gene symbol	ST3GAL6
Synonyms (NCBI Gene)	SIAT10ST3GALVI
Chromosome	3
Chromosome location	3q12.1
Summary	The protein encoded by this gene is a member of the sialyltransferase family. Members of this family are enzymes that transfer sialic acid from the activated cytidine 5`-monophospho-N-acetylneuraminic acid to terminal positions on sialylated glycolipids (

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024498	hsa-miR-215-5p	Microarray	19074876
MIRT026490	hsa-miR-192-5p	Microarray	19074876
MIRT649450	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT649448	hsa-miR-1248	HITS-CLIP	23824327
MIRT649447	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT649446	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT649450	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT649448	hsa-miR-1248	HITS-CLIP	23824327
MIRT649447	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT649446	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT1393586	hsa-miR-138	CLIP-seq
MIRT1393587	hsa-miR-3182	CLIP-seq
MIRT1393588	hsa-miR-320e	CLIP-seq
MIRT1393589	hsa-miR-323-5p	CLIP-seq
MIRT1393590	hsa-miR-4303	CLIP-seq
MIRT1393591	hsa-miR-4456	CLIP-seq
MIRT1393592	hsa-miR-4682	CLIP-seq
MIRT1393593	hsa-miR-627	CLIP-seq
MIRT1393594	hsa-miR-876-3p	CLIP-seq
MIRT1393595	hsa-miR-924	CLIP-seq
MIRT2118131	hsa-miR-101	CLIP-seq
MIRT2118132	hsa-miR-144	CLIP-seq
MIRT2118133	hsa-miR-4662a-5p	CLIP-seq
MIRT2118134	hsa-miR-4716-5p	CLIP-seq
MIRT2118135	hsa-miR-582-5p	CLIP-seq
MIRT2118131	hsa-miR-101	CLIP-seq
MIRT2340114	hsa-miR-1226	CLIP-seq
MIRT2340115	hsa-miR-1324	CLIP-seq
MIRT1393586	hsa-miR-138	CLIP-seq
MIRT2118132	hsa-miR-144	CLIP-seq
MIRT2340116	hsa-miR-27a	CLIP-seq
MIRT2340117	hsa-miR-27b	CLIP-seq
MIRT1393588	hsa-miR-320e	CLIP-seq
MIRT1393589	hsa-miR-323-5p	CLIP-seq
MIRT1393591	hsa-miR-4456	CLIP-seq
MIRT2340118	hsa-miR-4514	CLIP-seq
MIRT2340119	hsa-miR-4645-3p	CLIP-seq
MIRT2340120	hsa-miR-4645-5p	CLIP-seq
MIRT2118133	hsa-miR-4662a-5p	CLIP-seq
MIRT2340121	hsa-miR-4673	CLIP-seq
MIRT2340122	hsa-miR-4692	CLIP-seq
MIRT2118134	hsa-miR-4716-5p	CLIP-seq
MIRT2340123	hsa-miR-4733-3p	CLIP-seq
MIRT2340124	hsa-miR-513a-5p	CLIP-seq
MIRT2118135	hsa-miR-582-5p	CLIP-seq
MIRT1393594	hsa-miR-876-3p	CLIP-seq
MIRT2460595	hsa-miR-1323	CLIP-seq
MIRT2460596	hsa-miR-548ac	CLIP-seq
MIRT2460597	hsa-miR-548ae	CLIP-seq
MIRT2460598	hsa-miR-548aj	CLIP-seq
MIRT2460599	hsa-miR-548am	CLIP-seq
MIRT2460600	hsa-miR-548d-3p	CLIP-seq
MIRT2460601	hsa-miR-548o	CLIP-seq
MIRT2460602	hsa-miR-548x	CLIP-seq
MIRT2460603	hsa-miR-548z	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IDA	10206952
GO:0006486	Process	Protein glycosylation	IEA
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IDA	10206952
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	IBA
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0009247	Process	Glycolipid biosynthetic process	IBA
GO:0009247	Process	Glycolipid biosynthetic process	IDA	10206952
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10206952
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	TAS
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071354	Process	Cellular response to interleukin-6	IEP	17944600

MIM	HGNC	e!Ensembl
607156	18080	ENSG00000064225

Q9Y274

Protein name

Type 2 lactosamine alpha-2,3-sialyltransferase (EC 2.4.3.6) (CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI) (ST3Gal VI) (ST3GalVI) (Sialyltransferase 10)

Protein function

Transfers the sialyl residue from CMP-N-acetyl-beta-neuraminate to the terminal galactose residue on sugar chains of glycoproteins and glycolipids (PubMed:10206952, PubMed:26692484). It's alpha-2,3-sialyltransferase activity is specific toward t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	62 → 329	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQF
HPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVV
VGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDP
NTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYE
LLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSL
MNKNAYHNVTAEQLFLKDIIEKNLVINLTQD

Sequence length

331

Interactions

View interactions

	KEGG		Reactome
	Glycosphingolipid biosynthesis - lacto and neolacto series Metabolic pathways		Keratan sulfate biosynthesis Sialic acid metabolism Lewis blood group biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Inhibit	34135905	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Associate	31257275	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Associate	31257275	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Associate	26367242	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	27993161	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	31509989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	10206952	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	29459023	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Stimulate	33649796	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscle Weakness	Associate	31257275	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22025563, 28977470, 33579893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	32929335	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	37434153	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	32929335	★★★★★ ★☆☆☆☆ Found in Text Mining only

ST3GAL6 (ST3 beta-galactoside alpha-2,3-sialyltransferase 6)