Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10397
Gene name Gene Name - the full gene name approved by the HGNC.	N-myc downstream regulated 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NDRG1
Synonyms (NCBI Gene) Gene synonyms aliases	CAP43, CMT4D, DRG-1, DRG1, GC4, HMSNL, NDR1, NMSL, PROXY1, RIT42, RTP, TARG1, TDD5
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.22
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation

Show/Hide all(9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs11575976	C>G,T	Pathogenic, uncertain-significance	Splice acceptor variant
rs119483085	G>A	Pathogenic	Upstream transcript variant, genic upstream transcript variant, stop gained, coding sequence variant
rs143549909	G>A,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, missense variant, coding sequence variant
rs145871479	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	5 prime UTR variant, intron variant, coding sequence variant, genic upstream transcript variant, missense variant
rs201959970	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Synonymous variant, coding sequence variant
rs879254290	->G	Pathogenic	Frameshift variant, coding sequence variant
rs1060503092	C>T	Pathogenic	Splice donor variant, genic upstream transcript variant, intron variant
rs1586446057	C>T	Likely-pathogenic	Splice donor variant, genic upstream transcript variant
rs1588216753	C>A	Likely-pathogenic	Splice acceptor variant

Show/Hide all(216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018414	hsa-miR-335-5p	Microarray	18185580
MIRT025409	hsa-miR-34a-5p	Proteomics	21566225
MIRT025409	hsa-miR-34a-5p	Proteomics	21566225
MIRT025409	hsa-miR-34a-5p	Proteomics	21566225
MIRT052351	hsa-let-7b-5p	CLASH	23622248
MIRT041050	hsa-miR-505-3p	CLASH	23622248
MIRT038043	hsa-miR-423-5p	CLASH	23622248
MIRT438101	hsa-miR-182-5p	Luciferase reporter assay	23874837
MIRT438101	hsa-miR-182-5p	Luciferase reporter assay	23874837
MIRT224490	hsa-miR-4715-5p	HITS-CLIP	23824327
MIRT224489	hsa-miR-4259	HITS-CLIP	23824327
MIRT675156	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT675155	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT675154	hsa-miR-564	HITS-CLIP	23824327
MIRT675153	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT675152	hsa-miR-4284	HITS-CLIP	23824327
MIRT675151	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT675150	hsa-miR-7977	HITS-CLIP	23824327
MIRT544738	hsa-miR-548n	PAR-CLIP	21572407
MIRT544737	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT544736	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT544735	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT544734	hsa-miR-1265	PAR-CLIP	21572407
MIRT544733	hsa-miR-512-3p	PAR-CLIP	21572407
MIRT544732	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT544731	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT544730	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT240124	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT240120	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT240121	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT240123	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT544729	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT544728	hsa-miR-7160-5p	PAR-CLIP	21572407
MIRT544727	hsa-miR-3135b	PAR-CLIP	21572407
MIRT544726	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT544725	hsa-miR-4533	PAR-CLIP	21572407
MIRT544724	hsa-miR-3202	PAR-CLIP	21572407
MIRT544723	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT544722	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT544721	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT544720	hsa-miR-548aw	PAR-CLIP	21572407
MIRT442085	hsa-miR-548a-3p	PAR-CLIP	22100165
MIRT442084	hsa-miR-548ar-3p	PAR-CLIP	22100165
MIRT442083	hsa-miR-548az-3p	PAR-CLIP	22100165
MIRT442082	hsa-miR-548e-3p	PAR-CLIP	22100165
MIRT442081	hsa-miR-548f-3p	PAR-CLIP	22100165
MIRT442080	hsa-miR-1243	PAR-CLIP	22100165
MIRT442079	hsa-miR-4705	PAR-CLIP	22100165
MIRT442078	hsa-miR-378j	PAR-CLIP	22100165
MIRT442076	hsa-miR-6839-5p	PAR-CLIP	22100165
MIRT442077	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT442075	hsa-miR-3167	PAR-CLIP	22100165
MIRT442074	hsa-miR-876-5p	PAR-CLIP	22100165
MIRT442073	hsa-miR-1290	PAR-CLIP	22100165
MIRT442072	hsa-miR-4503	PAR-CLIP	22100165
MIRT224490	hsa-miR-4715-5p	HITS-CLIP	23824327
MIRT224489	hsa-miR-4259	HITS-CLIP	23824327
MIRT675156	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT675155	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT675154	hsa-miR-564	HITS-CLIP	23824327
MIRT675153	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT675152	hsa-miR-4284	HITS-CLIP	23824327
MIRT675151	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT675150	hsa-miR-7977	HITS-CLIP	23824327
MIRT544738	hsa-miR-548n	PAR-CLIP	21572407
MIRT544737	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT544736	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT544735	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT544734	hsa-miR-1265	PAR-CLIP	21572407
MIRT544733	hsa-miR-512-3p	PAR-CLIP	21572407
MIRT544732	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT544731	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT544730	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT240124	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT240120	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT240121	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT240123	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT544729	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT544728	hsa-miR-7160-5p	PAR-CLIP	21572407
MIRT544727	hsa-miR-3135b	PAR-CLIP	21572407
MIRT544726	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT544725	hsa-miR-4533	PAR-CLIP	21572407
MIRT544724	hsa-miR-3202	PAR-CLIP	21572407
MIRT544723	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT544722	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT544721	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT544720	hsa-miR-548aw	PAR-CLIP	21572407
MIRT442085	hsa-miR-548a-3p	PAR-CLIP	22100165
MIRT442084	hsa-miR-548ar-3p	PAR-CLIP	22100165
MIRT442083	hsa-miR-548az-3p	PAR-CLIP	22100165
MIRT442082	hsa-miR-548e-3p	PAR-CLIP	22100165
MIRT442081	hsa-miR-548f-3p	PAR-CLIP	22100165
MIRT442080	hsa-miR-1243	PAR-CLIP	22100165
MIRT442079	hsa-miR-4705	PAR-CLIP	22100165
MIRT442078	hsa-miR-378j	PAR-CLIP	22100165
MIRT442076	hsa-miR-6839-5p	PAR-CLIP	22100165
MIRT442077	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT442075	hsa-miR-3167	PAR-CLIP	22100165
MIRT442074	hsa-miR-876-5p	PAR-CLIP	22100165
MIRT442073	hsa-miR-1290	PAR-CLIP	22100165
MIRT442072	hsa-miR-4503	PAR-CLIP	22100165
MIRT1178161	hsa-miR-105	CLIP-seq
MIRT1178162	hsa-miR-1197	CLIP-seq
MIRT1178163	hsa-miR-1251	CLIP-seq
MIRT1178164	hsa-miR-193a-3p	CLIP-seq
MIRT1178165	hsa-miR-193b	CLIP-seq
MIRT1178166	hsa-miR-3914	CLIP-seq
MIRT1178167	hsa-miR-4436b-3p	CLIP-seq
MIRT1178168	hsa-miR-4632	CLIP-seq
MIRT1178169	hsa-miR-4682	CLIP-seq
MIRT1178170	hsa-miR-4685-5p	CLIP-seq
MIRT1178171	hsa-miR-4690-3p	CLIP-seq
MIRT1178172	hsa-miR-4779	CLIP-seq
MIRT1178173	hsa-miR-490-3p	CLIP-seq
MIRT1178174	hsa-miR-885-3p	CLIP-seq
MIRT1178175	hsa-miR-2052	CLIP-seq
MIRT1178176	hsa-miR-3127-3p	CLIP-seq
MIRT1178177	hsa-miR-3152-5p	CLIP-seq
MIRT1178178	hsa-miR-3667-3p	CLIP-seq
MIRT1178179	hsa-miR-3679-3p	CLIP-seq
MIRT1178180	hsa-miR-4640-3p	CLIP-seq
MIRT1178181	hsa-miR-4774-3p	CLIP-seq
MIRT1178182	hsa-miR-556-3p	CLIP-seq
MIRT1178183	hsa-miR-668	CLIP-seq
MIRT1551645	hsa-miR-1321	CLIP-seq
MIRT1551646	hsa-miR-3162-5p	CLIP-seq
MIRT1551647	hsa-miR-4739	CLIP-seq
MIRT1551648	hsa-miR-4756-5p	CLIP-seq
MIRT1551649	hsa-miR-583	CLIP-seq
MIRT1178162	hsa-miR-1197	CLIP-seq
MIRT1178167	hsa-miR-4436b-3p	CLIP-seq
MIRT1178170	hsa-miR-4685-5p	CLIP-seq
MIRT1178162	hsa-miR-1197	CLIP-seq
MIRT1178167	hsa-miR-4436b-3p	CLIP-seq
MIRT1178170	hsa-miR-4685-5p	CLIP-seq
MIRT2051538	hsa-miR-1231	CLIP-seq
MIRT2051539	hsa-miR-1282	CLIP-seq
MIRT2051540	hsa-miR-4288	CLIP-seq
MIRT2051541	hsa-miR-628-5p	CLIP-seq
MIRT2051542	hsa-miR-632	CLIP-seq
MIRT2280611	hsa-miR-1237	CLIP-seq
MIRT2280612	hsa-miR-3176	CLIP-seq
MIRT2280613	hsa-miR-3922-3p	CLIP-seq
MIRT2280614	hsa-miR-4256	CLIP-seq
MIRT2391447	hsa-miR-183	CLIP-seq
MIRT2391448	hsa-miR-199a-3p	CLIP-seq
MIRT2391449	hsa-miR-199b-3p	CLIP-seq
MIRT2391450	hsa-miR-2682	CLIP-seq
MIRT2391451	hsa-miR-3129-5p	CLIP-seq
MIRT2391452	hsa-miR-3714	CLIP-seq
MIRT2391453	hsa-miR-449c	CLIP-seq
MIRT2391454	hsa-miR-4700-3p	CLIP-seq
MIRT2391455	hsa-miR-4736	CLIP-seq
MIRT2391456	hsa-miR-548k	CLIP-seq
MIRT1551649	hsa-miR-583	CLIP-seq
MIRT2391457	hsa-miR-624	CLIP-seq
MIRT2454974	hsa-miR-3125	CLIP-seq
MIRT2454975	hsa-miR-3916	CLIP-seq
MIRT2454976	hsa-miR-4722-5p	CLIP-seq
MIRT2454977	hsa-miR-4768-3p	CLIP-seq
MIRT1551649	hsa-miR-583	CLIP-seq
MIRT2391448	hsa-miR-199a-3p	CLIP-seq
MIRT2391449	hsa-miR-199b-3p	CLIP-seq
MIRT2391450	hsa-miR-2682	CLIP-seq
MIRT2391451	hsa-miR-3129-5p	CLIP-seq
MIRT2579076	hsa-miR-337-3p	CLIP-seq
MIRT2579077	hsa-miR-338-5p	CLIP-seq
MIRT2579078	hsa-miR-3646	CLIP-seq
MIRT2579079	hsa-miR-3662	CLIP-seq
MIRT2391452	hsa-miR-3714	CLIP-seq
MIRT1178166	hsa-miR-3914	CLIP-seq
MIRT2280614	hsa-miR-4256	CLIP-seq
MIRT2579080	hsa-miR-4272	CLIP-seq
MIRT2391453	hsa-miR-449c	CLIP-seq
MIRT2579081	hsa-miR-4639-3p	CLIP-seq
MIRT2579082	hsa-miR-4668-3p	CLIP-seq
MIRT2579083	hsa-miR-4698	CLIP-seq
MIRT2391454	hsa-miR-4700-3p	CLIP-seq
MIRT2579084	hsa-miR-4712-3p	CLIP-seq
MIRT2579085	hsa-miR-4714-5p	CLIP-seq
MIRT2579086	hsa-miR-4792	CLIP-seq
MIRT1178173	hsa-miR-490-3p	CLIP-seq
MIRT2579087	hsa-miR-539	CLIP-seq
MIRT2391456	hsa-miR-548k	CLIP-seq
MIRT2391457	hsa-miR-624	CLIP-seq
MIRT2579088	hsa-miR-873	CLIP-seq
MIRT1178174	hsa-miR-885-3p	CLIP-seq
MIRT1178164	hsa-miR-193a-3p	CLIP-seq
MIRT1178165	hsa-miR-193b	CLIP-seq
MIRT2391448	hsa-miR-199a-3p	CLIP-seq
MIRT2391449	hsa-miR-199b-3p	CLIP-seq
MIRT2391450	hsa-miR-2682	CLIP-seq
MIRT2391451	hsa-miR-3129-5p	CLIP-seq
MIRT2579076	hsa-miR-337-3p	CLIP-seq
MIRT2579077	hsa-miR-338-5p	CLIP-seq
MIRT2579078	hsa-miR-3646	CLIP-seq
MIRT2579079	hsa-miR-3662	CLIP-seq
MIRT2391452	hsa-miR-3714	CLIP-seq
MIRT1178166	hsa-miR-3914	CLIP-seq
MIRT2280614	hsa-miR-4256	CLIP-seq
MIRT2579080	hsa-miR-4272	CLIP-seq
MIRT2391453	hsa-miR-449c	CLIP-seq
MIRT1178168	hsa-miR-4632	CLIP-seq
MIRT2579081	hsa-miR-4639-3p	CLIP-seq
MIRT2579082	hsa-miR-4668-3p	CLIP-seq
MIRT2579083	hsa-miR-4698	CLIP-seq
MIRT2391454	hsa-miR-4700-3p	CLIP-seq
MIRT2579084	hsa-miR-4712-3p	CLIP-seq
MIRT2579085	hsa-miR-4714-5p	CLIP-seq
MIRT2579086	hsa-miR-4792	CLIP-seq
MIRT1178173	hsa-miR-490-3p	CLIP-seq
MIRT2579087	hsa-miR-539	CLIP-seq
MIRT2391456	hsa-miR-548k	CLIP-seq
MIRT2391457	hsa-miR-624	CLIP-seq
MIRT2579088	hsa-miR-873	CLIP-seq
MIRT1178174	hsa-miR-885-3p	CLIP-seq

Transcription factors

Show/Hide all(9)

Transcription factor	Regulation	Reference
AR	Unknown	17075604
ETS1	Repression	18381358
FOXD3	Activation	24269992
MYC	Repression	11936845
MYC	Unknown	21976667
MYCN	Activation	19322780
MYCN	Repression	11936845
MYCN	Unknown	14734473;23554972
SIRT1	Unknown	16314423

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15607035, 17220478, 17786215, 25416956, 32814053, 35271311
GO:0005634	Component	Nucleus	IDA	9766676
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9766676
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	15247272
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	15247272
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA	12432451
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IDA	12432451
GO:0007165	Process	Signal transduction	IBA
GO:0008017	Function	Microtubule binding	IDA	15247272
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010038	Process	Response to metal ion	TAS	9605764
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016151	Function	Nickel cation binding	EXP	36139110
GO:0016151	Function	Nickel cation binding	IPI	36139110
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IEP	9766676
GO:0031267	Function	Small GTPase binding	IDA	17786215
GO:0032287	Process	Peripheral nervous system myelin maintenance	IEA
GO:0043015	Function	Gamma-tubulin binding	IDA	15247272
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045296	Function	Cadherin binding	IDA	17786215
GO:0045576	Process	Mast cell activation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17786215
GO:0055038	Component	Recycling endosome membrane	IDA	17786215
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071456	Process	Cellular response to hypoxia	IEP	20810912

MIM	HGNC	e!Ensembl
605262	7679	ENSG00000104419

Protein

UniProt ID

Q92597

Protein name

Protein NDRG1 (Differentiation-related gene 1 protein) (DRG-1) (N-myc downstream-regulated gene 1 protein) (Nickel-specific induction protein Cap43) (Reducing agents and tunicamycin-responsive protein) (RTP) (Rit42)

Protein function

Stress-responsive protein involved in hormone responses, cell growth, and differentiation. Acts as a tumor suppressor in many cell types. Necessary but not sufficient for p53/TP53-mediated caspase activation and apoptosis. Has a role in cell tra

PDB

6ZMM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03096	Ndr	34 → 316	Ndr family	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous; expressed most prominently in placental membranes and prostate, kidney, small intestine, and ovary tissues. Also expressed in heart, brain, skeletal muscle, lung, liver and pancreas. Low levels in peripheral blood leukocyte

Sequence

MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVIL
TYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAE
MLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKI
SGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIE
RPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGT
RSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Sequence length

394

Interactions

View interactions

	Reactome
			TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Charcot-Marie-Tooth Disease	charcot-marie-tooth disease type 4, charcot-marie-tooth disease type 4d, Charcot-Marie-Tooth Disease	rs1586446057, rs1588216753, rs1855957969, rs1586407193, rs758718584, rs119483085, rs879254290, rs1060503092	N/A

Show/Hide Text Mining Associations (95)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	24299561
Adenocarcinoma Follicular	Stimulate	20835551
Adenoma Pleomorphic	Associate	32345665
Astrocytoma	Associate	33709284
Brain Neoplasms	Associate	40530439
Breast Neoplasms	Stimulate	21909787
Breast Neoplasms	Associate	23899187, 25732125, 26852918, 30337371, 30497328, 31443698, 35508987, 35859293, 36127332, 36307826, 37338518, 37600707, 37854018, 39770056, 40530439
Breast Neoplasms	Inhibit	31253870
Carcinogenesis	Stimulate	14966915
Carcinogenesis	Associate	18377423, 18653908, 21909787, 22678098, 26245647
Carcinoma Endometrioid	Associate	18653908, 39603644
Carcinoma Hepatocellular	Stimulate	17170744
Carcinoma Hepatocellular	Associate	19682504, 24302615, 25335733, 26883192, 27831650, 29795057, 33726698, 34355586, 34745496, 37517087, 38013127, 38097352, 40465781
Carcinoma Merkel Cell	Inhibit	31694959
Carcinoma Non Small Cell Lung	Associate	20853080, 24299561
Carcinoma Non Small Cell Lung	Stimulate	30443171
Carcinoma Renal Cell	Associate	37298315
Carcinoma Renal Cell	Stimulate	40234880
Carcinoma Squamous Cell	Associate	24299561
Charcot Marie Tooth Disease	Associate	23163601, 24136616, 33305529
Cholangiocarcinoma	Associate	39199357
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Stimulate	12429530
Colitis Ulcerative	Associate	36445533
Colorectal Neoplasms	Associate	14966915, 22187533, 23973486, 26895766, 32564470, 34965023, 36862005
Colorectal Neoplasms	Stimulate	17569115
Colorectal Neoplasms	Inhibit	23874544
Crohn Disease	Associate	26636514
Death	Associate	33483585
Demyelinating Diseases	Associate	28981455, 36499320
Digestive System Diseases	Associate	34105295
Drug Related Side Effects and Adverse Reactions	Inhibit	30443171
Drug Related Side Effects and Adverse Reactions	Associate	39770056
Endometrial Hyperplasia	Stimulate	18377423
Endometrial Neoplasms	Associate	18377423, 22678098
Esophageal Neoplasms	Associate	19414333, 25232961
Esophageal Squamous Cell Carcinoma	Associate	32106831
Fetal Growth Retardation	Stimulate	16314423, 26028238
Glioblastoma	Associate	30538287, 35813230
Glioma	Associate	24395351, 27698340, 33709284, 34913078, 35813230
Hepatitis C	Inhibit	29118118
Hereditary Sensory and Motor Neuropathy	Associate	10831399, 24136616
Hypoxia	Stimulate	12429530, 15341671, 16314423, 16832411, 21976667, 22116304, 23549264, 26852918, 29303911, 36127332
Hypoxia	Associate	18381358, 18653908, 26028238, 36140669, 36807042
Hypoxia	Inhibit	30497328
Hypoxia Brain	Associate	12429530, 26028238
Hypoxia Brain	Stimulate	15341671, 19414333, 40530439
Hypoxia Brain	Inhibit	16314423
Inflammatory Bowel Diseases	Associate	26636514
Kidney Neoplasms	Associate	29991691
Lung Neoplasms	Associate	24299561, 30443171
Lymphatic Metastasis	Associate	23899187, 27154576
Lymphatic Metastasis	Stimulate	23973486, 30914736, 37793886, 39603644
Lymphoma Large B Cell Diffuse	Associate	26245647
Malformations of Cortical Development	Stimulate	28222113
Meningioma	Associate	34385566
Moyamoya Disease	Associate	37400835
Multiple Sclerosis	Associate	28981455
Multiple Sclerosis	Inhibit	36499320
Nasopharyngeal Carcinoma	Inhibit	25520514
Nasopharyngeal Carcinoma	Associate	29738439, 37479693
Nasopharyngeal Neoplasms	Inhibit	29738439
Neoplasm Invasiveness	Stimulate	17170744
Neoplasm Metastasis	Associate	14966915, 20173668, 23899187, 25335733, 31072445, 32298965, 34965023, 36594086, 37329997, 37793886, 40530439
Neoplasm Metastasis	Inhibit	17170744, 20853080, 21052891, 22453918, 23287991, 23377825, 23634903, 23874544, 25520514, 25860930, 26895766, 27894074, 29679718, 30337371, 30679310 View all (6 more)
Neoplasm Metastasis	Stimulate	23973486
Neoplasms	Stimulate	12429530, 15341671, 34355586
Neoplasms	Associate	17170744, 18377423, 19414333, 20173668, 20835551, 21912630, 22678098, 23287991, 23874837, 23973486, 24269992, 25860930, 26349604, 26852918, 26895766 View all (19 more)
Neoplasms	Inhibit	18712736, 21976667, 23634903, 23874544, 23899187, 24302615, 25335733, 29303911, 29738439, 30497328, 31694959, 33305529, 33398037, 35813230
Neoplastic Syndromes Hereditary	Associate	15247272
Nervous System Diseases	Associate	27716814
Neuroblastoma	Associate	24269992, 27894074, 35008802
Neuroendocrine Tumors	Associate	26894863
Neuropathy hereditary motor and sensory LOM type	Associate	24136616, 39201732
Osteosarcoma	Associate	21706236, 28906492, 34099022
Ovarian Neoplasms	Associate	26735889, 35840928, 37793886
Pancreatic Neoplasms	Associate	16832411, 20173668, 29303911
Peritonitis	Associate	37793886
Personality Disorders	Associate	24269992
Pre Eclampsia	Associate	26388242
Prostatic Neoplasms	Associate	15247272, 18712736, 19649210, 20118910, 20466611, 21178489, 23287991, 23377825, 23874837, 24386364, 33398037, 33483585, 34298089, 34785213, 37047218
Prostatic Neoplasms	Inhibit	17220478, 23634903, 26895766
Prostatitis	Inhibit	10428464
Prostatitis	Associate	22116304, 33398037
Rectal Neoplasms	Associate	29801473
Sarcoma Ewing	Associate	32968877
Sick Sinus Syndrome	Associate	23973486
Stomach Neoplasms	Associate	15761963, 21052891
Stomach Neoplasms	Inhibit	27154576
Thymus Neoplasms	Associate	28506304
Thyroid Cancer Papillary	Stimulate	20835551
Triple Negative Breast Neoplasms	Associate	35459269, 36594086
Urethral Neoplasms	Associate	38561462
Urinary Bladder Neoplasms	Associate	26249737, 30813460
Urinary Bladder Neoplasms	Stimulate	30914736
Uterine Cervical Neoplasms	Associate	18217980, 31242951, 32975231, 37329997

NDRG1 (N-myc downstream regulated 1)