Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10394
Gene name Gene Name - the full gene name approved by the HGNC.
Proteoglycan 3, pro eosinophil major basic protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRG3
Synonyms (NCBI Gene) Gene synonyms aliases
MBP2, MBPH
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017446 hsa-miR-335-5p Microarray 18185580
Transcription factors
Transcription factor Regulation Reference
TP53 Unknown 12135761
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001694 Process Histamine biosynthetic process IDA 10318872
GO:0005576 Component Extracellular region TAS
GO:0006955 Process Immune response IEA
GO:0017148 Process Negative regulation of translation IDA 10318872
GO:0019370 Process Leukotriene biosynthetic process IDA 10318872
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606814 9363 ENSG00000156575
Protein
UniProt ID Q9Y2Y8
Protein name Proteoglycan 3 (Eosinophil major basic protein homolog) (Prepro-major basic protein homolog) (Prepro-MBPH)
Protein function Possesses similar cytotoxic and cytostimulatory activities to PRG2/MBP. In vitro, stimulates neutrophil superoxide production and IL8 release, and histamine and leukotriene C4 release from basophils.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 117 225 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in bone marrow. Not detected in placenta. {ECO:0000269|PubMed:10318872}.
Sequence
MQCLLLLPFLLLGTVSALHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAE
GEEVKASACQDNFEDEEAMESDPAALDKDFQCPREEDIVEVQGSPRCKICRYLLVRTPKT
FAEAQNVCSRCYGGNLVSIHDFNFNYRIQCCTSTVNQAQVWIGGNLRGWFLWKRFCWTDG
SHWNFAYWSPGQPGNGQGSCVALCTKGGYWRRAQCDKQLPFVCSF
Sequence length 225
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertrophic cardiomyopathy Hypertrophic cardiomyopathy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Crohn Disease Associate 22412388
Hypereosinophilic Syndrome Associate 17082653