PRG3 (proteoglycan 3, pro eosinophil major basic protein 2)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10394
Gene name Gene Name - the full gene name approved by the HGNC.
Proteoglycan 3, pro eosinophil major basic protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRG3
Synonyms (NCBI Gene) Gene synonyms aliases
MBP2, MBPH
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT017446 hsa-miR-335-5p Microarray 18185580
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
TP53 Unknown 12135761
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0001694 Process Histamine biosynthetic process IDA 10318872
GO:0005576 Component Extracellular region TAS
GO:0017148 Process Negative regulation of translation IDA 10318872
GO:0019370 Process Leukotriene biosynthetic process IDA 10318872
GO:0030021 Function Extracellular matrix structural constituent conferring compression resistance HDA 28344315
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606814 9363 ENSG00000156575
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9Y2Y8
Protein name Proteoglycan 3 (Eosinophil major basic protein homolog) (Prepro-major basic protein homolog) (Prepro-MBPH)
Protein function Possesses similar cytotoxic and cytostimulatory activities to PRG2/MBP. In vitro, stimulates neutrophil superoxide production and IL8 release, and histamine and leukotriene C4 release from basophils.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 117 → 225 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in bone marrow. Not detected in placenta. {ECO:0000269|PubMed:10318872}.
Sequence 
MQCLLLLPFLLLGTVSALHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAE
GEEVKASACQDNFEDEEAMESDPAALDKDFQCPREEDIVEVQGSPRCKICRYLLVRTPKT
FAEAQNVCSRCYGGNLVSIHDFNFNYRIQCCTSTVNQAQVWIGGNLRGWFLWKRFCWTDG
SHWNFAYWSPGQPGNGQGSCVALCTKGGYWRRAQCDKQLPFVCSF
Sequence length 225
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Neutrophil degranulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Hypertrophic cardiomyopathy Hypertrophic cardiomyopathy GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Crohn Disease Associate 22412388
Hypereosinophilic Syndrome Associate 17082653