Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10367
Gene name Gene Name - the full gene name approved by the HGNC.
Mitochondrial calcium uptake 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MICU1
Synonyms (NCBI Gene) Gene synonyms aliases
CALC, CBARA1, EFHA3, MPXPS, ara CALC
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an essential regulator of mitochondrial Ca2+ uptake under basal conditions. The encoded protein interacts with the mitochondrial calcium uniporter, a mitochondrial inner membrane Ca2+ channel, and is essential in preventing mitochondrial
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs369915689 C>T Pathogenic Splice donor variant
rs375664373 C>A,G Likely-pathogenic Coding sequence variant, genic upstream transcript variant, non coding transcript variant, missense variant
rs538329212 G>A,C,T Pathogenic Non coding transcript variant, genic upstream transcript variant, synonymous variant, coding sequence variant, stop gained, missense variant
rs749124658 C>- Pathogenic Coding sequence variant, genic upstream transcript variant, frameshift variant, non coding transcript variant
rs754639936 C>G,T Pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037375 hsa-miR-877-5p CLASH 23622248
MIRT1148407 hsa-miR-15a CLIP-seq
MIRT1148408 hsa-miR-15b CLIP-seq
MIRT1148409 hsa-miR-16 CLIP-seq
MIRT1148410 hsa-miR-195 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005246 Function Calcium channel regulator activity IDA 32494073
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 23101630, 24514027
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding TAS 26975899
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605084 1530 ENSG00000107745
Protein
UniProt ID Q9BPX6
Protein name Calcium uptake protein 1, mitochondrial (Atopy-related autoantigen CALC) (ara CALC) (Calcium-binding atopy-related autoantigen 1) (allergen Hom s 4)
Protein function Calcium sensor of the mitochondrial calcium uniporter (MCU) channel, which senses calcium level via its EF-hand domains (PubMed:20693986, PubMed:23101630, PubMed:23747253, PubMed:24313810, PubMed:24332854, PubMed:24503055, PubMed:24560927, PubMe
PDB 4NSC , 4NSD , 6K7Y , 6LB7 , 6LB8 , 6LE5 , 6WDN , 6WDO , 6XJV , 6XJX , 6XQN , 6XQO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13202 EF-hand_5 223 247 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in epithelial cell lines. Strongly expressed in epidermal keratinocytes and dermal endothelial cells. {ECO:0000269|PubMed:16002733, ECO:0000269|PubMed:9806765}.
Sequence
MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESP
PCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRA
YSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKK
ISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDM
EEFEQVQ
SIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQ
RKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLT
FQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALF
DCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ
Sequence length 476
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Mitochondrial calcium ion transport
Processing of SMDT1
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Proximal myopathy with extrapyramidal signs proximal myopathy with extrapyramidal signs rs375664373, rs1135401814, rs749124658, rs538329212, rs754639936, rs369915689 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Sarcoidosis Sarcoidosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anophthalmia with pulmonary hypoplasia Associate 32799327
Basal Ganglia Diseases Associate 28132899, 39973469
Breast Neoplasms Associate 24802861
Cognition Disorders Associate 28132899
Drug Related Side Effects and Adverse Reactions Associate 30403999
Inflammation Stimulate 16002632
Leukocytosis Associate 32323775
Muscle Weakness Associate 28132899, 39973469
Muscular Diseases Associate 39973469
Muscular Dystrophies Limb Girdle Associate 32293312, 39973469